Property Summary

NCBI Gene PubMed Count 20
PubMed Score 13.90
PubTator Score 14.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Adams Oliver syndrome 6 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Disease Target Count Z-score Confidence
Celiac disease 116 0.0 3.0
Schizophrenia 1160 0.0 1.0
Disease Target Count Z-score Confidence
Adams-Oliver syndrome 15 6.831 3.4
Disease Target Count
Adams-Oliver Syndrome 1 6

Expression

  Differential Expression (13)

Disease log2 FC p
Alzheimer's disease 1.200 2.3e-02
astrocytoma 1.100 5.7e-17
Astrocytoma, Pilocytic 1.400 5.3e-08
group 3 medulloblastoma -1.200 4.7e-04
invasive ductal carcinoma -1.100 5.6e-03
lung adenocarcinoma -1.500 1.4e-11
lung carcinoma -2.600 2.7e-25
medulloblastoma, large-cell -1.100 1.6e-03
non-small cell lung cancer -1.958 2.5e-27
oligodendroglioma 1.200 3.3e-03
Pick disease 1.200 2.9e-03
spina bifida 1.105 2.3e-02
tuberculosis -1.100 1.3e-06

Synonym

Accession Q2M1Z3 Q9ULL6
Symbols AOS1
CDGAP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (10)

AA Sequence

MKNKGAKQKLKRKGAASAFGCDLTEYLESSGQDVPYVLKSCAEFIETHGIVDGIYRLSGVTSNIQRLRQE      1 - 70
FGSDQCPDLTREVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTEAVSHCPEEGQLARIQNVIQELPP     71 - 140
SHYRTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLLRSKEIEATGCNGDAAFLAVRVQQVVIEFILN    141 - 210
HVDQIFNNGAPGSLENDENRPIMKSLTLPALSLPMKLVSLEEAQARSLATNHPARKERRENSLPEIVPPM    211 - 280
GTLFHTVLELPDNKRKLSSKSKKWKSIFNLGRSGSDSKSKLSRNGSVFVRGQRLSVEKATIRPAKSMDSL    281 - 350
CSVPVEGKETKGNFNRTVTTGGFFIPATKMHSTGTGSSCDLTKQEGEWGQEGMPPGAEGGFDVSSDRSHL    351 - 420
QGAQARPPPEQLKVFRPVEDPESEQTAPKMLGMFYTSNDSPSKSVFTSSLFQMEPSPRNQRKALNISEPF    421 - 490
AVSVPLRVSAVISTNSTPCRTPPKELQSLSSLEEFSFHGSESGGWPEEEKPLGAETSAASVPKKAGLEDA    491 - 560
KAVPEAPGTVECSKGLSQEPGAHLEEKKTPESSLSSQHLNELEKRPNPEKVVEEGREAGEMESSTLQESP    561 - 630
RARAEAVLLHEMDEDDLANALIWPEIQQELKIIESEEELSSLPPPALKTSPIQPILESSLGPFIPSEPPG    631 - 700
SLPCGSFPAPVSTPLEVWTRDPANQSTQGASTAASREKPEPEQGLHPDLASLAPLEIVPFEKASPQATVE    701 - 770
VGGPGNLSPPLPPAPPPPTPLEESTPVLLSKGGPEREDSSRKLRTDLYIDQLKSQDSPEISSLCQGEEAT    771 - 840
PRHSDKQNSKNAASEGKGCGFPSPTREVEIVSQEEEDVTHSVQEPSDCDEDDTVTDIAQHGLEMVEPWEE    841 - 910
PQWVTSPLHSPTLKDAHKAQVQGLQGHQLEKRLSHRPSLRQSHSLDSKPTVKSQWTLEVPSSSSCANLET    911 - 980
ERNSDPLQPQAPRREITGWDEKALRSFREFSGLKGAEAPPNQKGPSGVQPNPAETSPISLAEGKELGTHL    981 - 1050
GHSSPQIRQGGVPGPESSKESSPSVQDSTSPGEHPAKLQLKSTECGPPKGKNRPSSLNLDPAIPIADLFW   1051 - 1120
FENVASFSSPGMQVSEPGDPKVTWMTSSYCKADPWRVYSQDPQDLDIVAHALTGRRNSAPVSVSAVRTSF   1121 - 1190
MVKMCQARAVPVIPPKIQYTQIPQPLPSQSSGENGVQPLERSQEGPSSTSGTTQKPAKDDSPSSLESSKE   1191 - 1260
EKPKQDPGAIKSSPVDATAPCMCEGPTLSPEPGSSNLLSTQDAVVQCRKRMSETEPSGDNLLSSKLERPS   1261 - 1330
GGSKPFHRSRPGRPQSLILFSPPFPIMDHLPPSSTVTDSKVLLSPIRSPTQTVSPGLLCGELAENTWVTP   1331 - 1400
EGVTLRNKMTIPKNGQRLETSTSCFYQPQRRSVILDGRSGRQIE                             1401 - 1444
//

Text Mined References (24)

PMID Year Title