Property Summary

NCBI Gene PubMed Count 25
Grant Count 27
R01 Count 20
Funding $3,426,781.08
PubMed Score 40.76
PubTator Score 21.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (11)

PMID Text
26788497 two multi-zinc finger transcription cofactors named ZNF423 and ZNF521 have been characterised as potent inhibitors of EBF1 and are emerging as potentially relevant contributors to the development of B-cell leukaemias
25219468 OAZ gene expression was highly enriched in mesenchymal stem cells (MSCs) compared with peripheral blood leukocytes and was increased in patients with systemic lupus erythematosus (SLE) compared with control subjects.
24081948 ZNF423 is a target for epigenetic deregulation and BMP2-dependent pathways in childhood B precursor acute lymphoblastic leukemia. Aberrant ZNF423 inhibits EBF-1 target genes, leads to a B cell maturation arrest in vivo and is associated with poor outcome of ETV6-RUNX1-negative acute lymphoblastic leukemia.
24081948 ZNF423 expression is associated with poor outcome of ETV6-RUNX1-negative B precursor acute lymphoblastic leukemia patients.
23878065 These findings suggest that expression of UBR5-ZNF423 protein might contribute to the transformation of a subset of Nasopharyngeal carcinoma
22863007 Study identifies by whole-exome resequencing, mutations of MRE11, ZNF423, and CEP164 as causing Nephronophthisis-related ciliopathies.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20359360 Elevated expression of OAZ transcripts in systemic lupus erythematosus PBLs were strongly correlated with disease activity.
20017333 The expression level of OAZ mRNA in the bone marrow and peripheral blood of SLE patients was significantly increased than those observed in normal controls.
19345331 Low ZNF423 expression is associated with neuroblastoma.
More...

AA Sequence

MHKKRVEEGEASDFSLAWDSSVTAAGGLEGEPECDQKTSRALEDRNSVTSQEERNEDDEDMEDESIYTCD      1 - 70
HCQQDFESLADLTDHRAHRCPGDGDDDPQLSWVASSPSSKDVASPTQMIGDGCDLGLGEEEGGTGLPYPC     71 - 140
QFCDKSFIRLSYLKRHEQIHSDKLPFKCTYCSRLFKHKRSRDRHIKLHTGDKKYHCHECEAAFSRSDHLK    141 - 210
IHLKTHSSSKPFKCTVCKRGFSSTSSLQSHMQAHKKNKEHLAKSEKEAKKDDFMCDYCEDTFSQTEELEK    211 - 280
HVLTRHPQLSEKADLQCIHCPEVFVDENTLLAHIHQAHANQKHKCPMCPEQFSSVEGVYCHLDSHRQPDS    281 - 350
SNHSVSPDPVLGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWTKVVYSCPYCSKRDFN    351 - 420
SLAVLEIHLKTIHADKPQQSHTCQICLDSMPTLYNLNEHVRKLHKNHAYPVMQFGNISAFHCNYCPEMFA    421 - 490
DINSLQEHIRVSHCGPNANPSDGNNAFFCNQCSMGFLTESSLTEHIQQAHCSVGSAKLESPVVQPTQSFM    491 - 560
EVYSCPYCTNSPIFGSILKLTKHIKENHKNIPLAHSKKSKAEQSPVSSDVEVSSPKRQRLSASANSISNG    561 - 630
EYPCNQCDLKFSNFESFQTHLKLHLELLLRKQACPQCKEDFDSQESLLQHLTVHYMTTSTHYVCESCDKQ    631 - 700
FSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRKEADLQVHVK    701 - 770
HSHLGNPAKAHKCIFCGETFSTEVELQCHITTHSKKYNCKFCSKAFHAIILLEKHLREKHCVFDAATENG    771 - 840
TANGVPPMATKKAEPADLQGMLLKNPEAPNSHEASEDDVDASEPMYGCDICGAAYTMEVLLQNHRLRDHN    841 - 910
IRPGEDDGSRKKAEFIKGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVT    911 - 980
HSKSLDTGTCRICKMPLQSEEEFIEHCQMHPDLRNSLTGFRCVVCMQTVTSTLELKIHGTFHMQKLAGSS    981 - 1050
AASSPNGQGLQKLYKCALCLKEFRSKQDLVKLDVNGLPYGLCAGCMARSANGQVGGLAPPEPADRPCAGL   1051 - 1120
RCPECSVKFESAEDLESHMQVDHRDLTPETSGPRKGTQTSPVPRKKTYQCIKCQMTFENEREIQIHVANH   1121 - 1190
MIEEGINHECKLCNQMFDSPAKLLCHLIEHSFEGMGGTFKCPVCFTVFVQANKLQQHIFAVHGQEDKIYD   1191 - 1260
CSQCPQKFFFQTELQNHTMSQHAQ                                                 1261 - 1284
//

Text Mined References (26)

PMID Year Title
26788497 2015 ZNF423 and ZNF521: EBF1 Antagonists of Potential Relevance in B-Lymphoid Malignancies.
25219468 2014 Restored immunosuppressive effect of mesenchymal stem cells on B cells after olfactory 1/early B cell factor-associated zinc-finger protein down-regulation in patients with systemic lupus erythematosus.
24081948 2013 Aberrant ZNF423 impedes B cell differentiation and is linked to adverse outcome of ETV6-RUNX1 negative B precursor acute lymphoblastic leukemia.
23878065 2013 Identification of a recurrent transforming UBR5-ZNF423 fusion gene in EBV-associated nasopharyngeal carcinoma.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22863007 2012 Exome capture reveals ZNF423 and CEP164 mutations, linking renal ciliopathies to DNA damage response signaling.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20359360 2010 Olf1/EBF associated zinc finger protein interfered with antinuclear antibody production in patients with systemic lupus erythematosus.
20017333 2009 [Gene expression of OAZ pathway in the patients of systemic lupus erythematosus].
More...