Property Summary

NCBI Gene PubMed Count 27
PubMed Score 45.33
PubTator Score 21.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Amphetamine-Related Disorders 74 0.0 0.0
NEPHRONOPHTHISIS 14 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.7
pancreatic cancer 2398 0.0 0.5
Disease Target Count Z-score Confidence
Attention deficit hyperactivity disorder 278 0.0 1.2
Disease Target Count Z-score Confidence
Joubert syndrome 66 3.849 1.9
Disease Target Count Z-score Confidence
Obesity 678 3.015 1.5
Disease Target Count
Arima syndrome 7

Expression

  Differential Expression (15)

Disease log2 FC p
Atopic dermatitis -1.300 8.4e-03
breast carcinoma -1.100 6.3e-16
cystic fibrosis -4.324 6.0e-07
ductal carcinoma in situ -1.400 6.2e-03
ependymoma 2.400 3.2e-02
group 3 medulloblastoma 2.100 7.5e-05
intraductal papillary-mucinous adenoma (... -3.700 3.9e-05
intraductal papillary-mucinous carcinoma... -4.000 3.2e-05
intraductal papillary-mucinous neoplasm ... -3.600 1.8e-03
invasive ductal carcinoma -2.100 7.0e-03
lung adenocarcinoma -1.051 7.7e-06
malignant mesothelioma 2.700 1.4e-05
oligodendroglioma 1.700 2.8e-02
ovarian cancer -1.100 3.5e-02
psoriasis -1.900 9.0e-07

Gene RIF (12)

AA Sequence

MHKKRVEEGEASDFSLAWDSSVTAAGGLEGEPECDQKTSRALEDRNSVTSQEERNEDDEDMEDESIYTCD      1 - 70
HCQQDFESLADLTDHRAHRCPGDGDDDPQLSWVASSPSSKDVASPTQMIGDGCDLGLGEEEGGTGLPYPC     71 - 140
QFCDKSFIRLSYLKRHEQIHSDKLPFKCTYCSRLFKHKRSRDRHIKLHTGDKKYHCHECEAAFSRSDHLK    141 - 210
IHLKTHSSSKPFKCTVCKRGFSSTSSLQSHMQAHKKNKEHLAKSEKEAKKDDFMCDYCEDTFSQTEELEK    211 - 280
HVLTRHPQLSEKADLQCIHCPEVFVDENTLLAHIHQAHANQKHKCPMCPEQFSSVEGVYCHLDSHRQPDS    281 - 350
SNHSVSPDPVLGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWTKVVYSCPYCSKRDFN    351 - 420
SLAVLEIHLKTIHADKPQQSHTCQICLDSMPTLYNLNEHVRKLHKNHAYPVMQFGNISAFHCNYCPEMFA    421 - 490
DINSLQEHIRVSHCGPNANPSDGNNAFFCNQCSMGFLTESSLTEHIQQAHCSVGSAKLESPVVQPTQSFM    491 - 560
EVYSCPYCTNSPIFGSILKLTKHIKENHKNIPLAHSKKSKAEQSPVSSDVEVSSPKRQRLSASANSISNG    561 - 630
EYPCNQCDLKFSNFESFQTHLKLHLELLLRKQACPQCKEDFDSQESLLQHLTVHYMTTSTHYVCESCDKQ    631 - 700
FSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRKEADLQVHVK    701 - 770
HSHLGNPAKAHKCIFCGETFSTEVELQCHITTHSKKYNCKFCSKAFHAIILLEKHLREKHCVFDAATENG    771 - 840
TANGVPPMATKKAEPADLQGMLLKNPEAPNSHEASEDDVDASEPMYGCDICGAAYTMEVLLQNHRLRDHN    841 - 910
IRPGEDDGSRKKAEFIKGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVT    911 - 980
HSKSLDTGTCRICKMPLQSEEEFIEHCQMHPDLRNSLTGFRCVVCMQTVTSTLELKIHGTFHMQKLAGSS    981 - 1050
AASSPNGQGLQKLYKCALCLKEFRSKQDLVKLDVNGLPYGLCAGCMARSANGQVGGLAPPEPADRPCAGL   1051 - 1120
RCPECSVKFESAEDLESHMQVDHRDLTPETSGPRKGTQTSPVPRKKTYQCIKCQMTFENEREIQIHVANH   1121 - 1190
MIEEGINHECKLCNQMFDSPAKLLCHLIEHSFEGMGGTFKCPVCFTVFVQANKLQQHIFAVHGQEDKIYD   1191 - 1260
CSQCPQKFFFQTELQNHTMSQHAQ                                                 1261 - 1284
//

Text Mined References (27)

PMID Year Title