Property Summary

NCBI Gene PubMed Count 11
Grant Count 16
R01 Count 4
Funding $3,041,536.43
PubMed Score 9.25
PubTator Score 20.73

Knowledge Summary

Patent (3,171)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.000

 GO Process (1)

Gene RIF (5)

PMID Text
26009545 Suggest that BK channel modulation by auxiliary gamma subunits depends on intra- and/or juxta-membrane mechanisms.
24639523 Regulation of the Ca(2+)- and voltage-activated large conductance Ca(2+)-activated K(+) (BK) channel by associated gamma1-subunits, was investigated.
21822313 The role of CAPC in the suppression of tumor growth and metastasis may be through its alteration of the tumor microenvironment.
20613726 in non-excitable LNCaP prostate cancer cells, BK channels can be activated at negative voltages without rises in [Ca(2+)](i) through their complex with an auxiliary protein, leucine-rich repeat (LRR)-containing protein 26 (LRRC26)
19250639 CAPC transcripts have differential expression in cancer cell lines, and that S-CAPC is translated into a 7.5 kDa protein using a non-AUG start codon.

AA Sequence

MRGPSWSRPRPLLLLLLLLSPWPVWAQVSATASPSGSLGAPDCPEVCTCVPGGLASCSALSLPAVPPGLS      1 - 70
LRLRALLLDHNRVRALPPGAFAGAGALQRLDLRENGLHSVHVRAFWGLGALQLLDLSANQLEALAPGTFA     71 - 140
PLRALRNLSLAGNRLARLEPAALGALPLLRSLSLQDNELAALAPGLLGRLPALDALHLRGNPWGCGCALR    141 - 210
PLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLALRDLAVVYTLGPASFLVSLASC    211 - 280
LALGSGLTACRARRRRLRTAALRPPRPPDPNPDPDPHGCASPADPGSPAAAAQA                    281 - 334
//

Text Mined References (13)

PMID Year Title
26009545 2015 Molecular basis for differential modulation of BK channel voltage-dependent gating by auxiliary ? subunits.
25825171 2015 Two distinct effects of PIP2 underlie auxiliary subunit-dependent modulation of Slo1 BK channels.
24639523 2014 Functional regulation of BK potassium channels by ?1 auxiliary subunits.
22547800 2012 BK potassium channel modulation by leucine-rich repeat-containing proteins.
21822313 2012 CAPC negatively regulates NF-?B activation and suppresses tumor growth and metastasis.
20613726 2010 LRRC26 auxiliary protein allows BK channel activation at resting voltage without calcium.
19250639 2009 Non-AUG translational initiation of a short CAPC transcript generating protein isoform.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16585525 2006 High expression of a cytokeratin-associated protein in many cancers.
More...