Property Summary

NCBI Gene PubMed Count 11
PubMed Score 11.26
PubTator Score 20.73

Knowledge Summary

Patent (3,171)

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.7e-12

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 3.7e-12

Gene RIF (5)

AA Sequence

MRGPSWSRPRPLLLLLLLLSPWPVWAQVSATASPSGSLGAPDCPEVCTCVPGGLASCSALSLPAVPPGLS      1 - 70
LRLRALLLDHNRVRALPPGAFAGAGALQRLDLRENGLHSVHVRAFWGLGALQLLDLSANQLEALAPGTFA     71 - 140
PLRALRNLSLAGNRLARLEPAALGALPLLRSLSLQDNELAALAPGLLGRLPALDALHLRGNPWGCGCALR    141 - 210
PLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLALRDLAVVYTLGPASFLVSLASC    211 - 280
LALGSGLTACRARRRRLRTAALRPPRPPDPNPDPDPHGCASPADPGSPAAAAQA                    281 - 334
//

Text Mined References (13)

PMID Year Title