Property Summary

NCBI Gene PubMed Count 18
PubMed Score 19.73
PubTator Score 18.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (6)

Disease log2 FC p
active Crohn's disease 3.647 7.2e-03
active ulcerative colitis 5.184 1.2e-04
head and neck cancer 1.300 3.9e-02
juvenile dermatomyositis -1.048 2.0e-12
uncontrolled asthma -1.300 2.8e-02
urothelial carcinoma -2.000 1.1e-05

Gene RIF (16)

AA Sequence

MTLWNGVLPFYPQPRHAAGFSVPLLIVILVFLALAASFLLILPGIRGHSRWFWLVRVLLSLFIGAEIVAV      1 - 70
HFSAEWFVGTVNTNTSYKAFSAARVTARVRLLVGLEGINITLTGTPVHQLNETIDYNEQFTWRLKENYAA     71 - 140
EYANALEKGLPDPVLYLAEKFTPSSPCGLYHQYHLAGHYASATLWVAFCFWLLSNVLLSTPAPLYGGLAL    141 - 210
LTTGAFALFGVFALASISSVPLCPLRLGSSALTTQYGAAFWVTLATGVLCLFLGGAVVSLQYVRPSALRT    211 - 280
LLDQSAKDCSQERGGSPLILGDPLHKQAALPDLKCITTNL                                  281 - 320
//

Text Mined References (21)

PMID Year Title