Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.15
PubTator Score 0.84

Knowledge Summary


No data available


  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia -1.100 3.5e-02
Breast cancer 1.100 2.3e-11
ductal carcinoma in situ 1.100 4.3e-03
group 3 medulloblastoma 1.200 5.9e-04
intraductal papillary-mucinous adenoma (... 1.200 5.9e-03
intraductal papillary-mucinous neoplasm ... 1.400 1.1e-02
invasive ductal carcinoma 1.500 1.4e-04
lung cancer 1.300 5.3e-04
non-small cell lung cancer 1.568 2.8e-25
osteosarcoma 1.931 4.3e-09

Gene RIF (1)

AA Sequence

DRAMSWKYSRGAGLGFSTAPNKIFYIDRNASKSVKLED                                    421 - 458

Text Mined References (18)

PMID Year Title