Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.15
PubTator Score 0.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.8214815038266E-25
Breast cancer 3099 2.33889619330147E-11
osteosarcoma 7933 4.27180769241739E-9
invasive ductal carcinoma 2950 1.39603575655556E-4
lung cancer 4473 1.46260963001238E-4
group 3 medulloblastoma 2254 5.89762156645888E-4
ductal carcinoma in situ 1745 0.00431003179945354
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00585442108384217
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0107056587635312
acute myeloid leukemia 785 0.034781392933332

Expression

Synonym

Accession Q1ED39 O43328 Q5FWF3
Symbols TSG118
FAM191A
101F10.1
C16orf88

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG

Gene RIF (1)

PMID Text
23333304 HIV-1 Vif downregulates the expression of lysine-rich nucleolar protein 1 (C16orf88, KNOP1) in Vif-expression T cells

AA Sequence

MITKTHKVDLGLPEKKKKKKVVKEPETRYSVLNNDDYFADVSPLRATSPSKSVAHGQAPEMPLVKKKKKK      1 - 70
KKGVSTLCEEHVEPETTLPARRTEKSPSLRKQVFGHLEFLSGEKKNKKSPLAMSHASGVKTSPDPRQGEE     71 - 140
ETRVGKKLKKHKKEKKGAQDPTAFSVQDPWFCEAREARDVGDTCSVGKKDEEQAALGQKRKRKSPREHNG    141 - 210
KVKKKKKIHQEGDALPGHSKPSRSMESSPRKGSKKKPVKVEAPEYIPISDDPKASAKKKMKSKKKVEQPV    211 - 280
IEEPALKRKKKKKRKESGVAGDPWKEETDTDLEVVLEKKGNMDEAHIDQVRRKALQEEIDRESGKTEASE    281 - 350
TRKWTGTQFGQWDTAGFENEDQKLKFLRLMGGFKNLSPSFSRPASTIARPNMALGKKAADSLQQNLQRDY    351 - 420
DRAMSWKYSRGAGLGFSTAPNKIFYIDRNASKSVKLED                                    421 - 458
//

Text Mined References (15)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...