Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.03
PubTator Score 0.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 5.1e-06

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma 1.400 5.1e-06

Synonym

Accession Q17RP2 B3KTZ8 Q96MQ4 Q9H0X7
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

AA Sequence

MANKGNKKRRQFSLEEKMKVVGAVDSGKRKGDVAKEFGITPSTLSTFLKDRTKFEEKVREASVGPQRKRM      1 - 70
RSALYDDIDKAVFAWFQEIHAKNILVTGSVIRKKALNLANMLGYDNFQASVGWLNRFRDRHGIALKAVCR     71 - 140
EDSDRLMNGLGIDKINEWHAGEIIKLIADYSPDDIFNADETGVFFQLLPQHTLAAKGDHCRGGKKAKQRL    141 - 210
TALFCCNASGTEKMRPLIVGRSASPHCLKNIHSLPCDYRANQWAWMTRDLFNEWLMQVDARMKRAERRIL    211 - 280
LLIDNCSAHNMLPHLERIQVGYLPSNCTAVLQPLNLGIIHTMKVLYQSHLLKQILLKLNSSEDQEEVDIK    281 - 350
QAIDMIAAAWWSVKPSTVVKCWQKAGIVPMEFAECDTESAASEPDIAIEKLWHTVAIATCVPNEVNFQDF    351 - 420
VTADDDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPKVTITEAISSVQKLRQFLSTCVDIPDAI    421 - 490
FGQLNGIDEYLMKRVTQTLIDSKITDFLQTK                                           491 - 521
//

Text Mined References (8)

PMID Year Title