Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 9.5e-07
Pick disease 1894 1.5e-06
ovarian cancer 8519 2.1e-04

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.871 9.5e-07
ovarian cancer -1.200 2.1e-04
Pick disease -1.100 1.5e-06

Gene RIF (1)

AA Sequence

MRAAGVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCLGVH      1 - 70
PVQGLPPEDQRSVTLKDLDVALPIIENYKDRLLAIGEVGLDFSPRFAGTGEQKEEQRQVLIRQIQLAKRL     71 - 140
NLPVNVHSRSAGRPTINLLQEQGAEKVLLHAFDGRPSVAMEGVRAGYFFSIPPSIIRSGQKQKLVKQLPL    141 - 210
TSICLETDSPALGPEKQVRNEPWNISISAEYIAQVKGISVEEVIEVTTQNALKLFPKLRHLLQK          211 - 274
//

Text Mined References (10)

PMID Year Title