Property Summary

NCBI Gene PubMed Count 37
PubMed Score 611.57
PubTator Score 189.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Osteoarthritis 184 0.0 0.0
Disease Target Count
Degenerative polyarthritis 115
Disease Target Count P-value
ovarian cancer 8520 6.3e-06
lung cancer 4740 2.4e-04
Waldenstrons macroglobulinemia 765 5.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.200 2.4e-04
ovarian cancer -1.400 6.3e-06
Waldenstrons macroglobulinemia 1.099 5.1e-03

 GO Function (1)

Gene RIF (14)

AA Sequence

MLRACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSH      1 - 70
FRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASAT     71 - 140
APTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQE    141 - 210
KQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGA    211 - 280
LKERRKAVDEAADALLKAKEELEKMKSVIENAKKKEVAGAKPHITAAEGKLHNMIVDLDNVVKKVQAAQS    281 - 350
EAKVVSQYHELVVQARDDFKRELDSITPEVLPGWKGMSVSDLADKLSTDDLNSLIAHAHRRIDQLNRELA    351 - 420
EQKATEKQHITLALEKQKLEEKRAFDSAVAKALEHHRSEIQAEQDRKIEEVRDAMENEMRTQLRRQAAAH    421 - 490
TDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQSHAVAE    491 - 560
EEARKAHQLWLSVEALKYSMKTSSAETPTIPLGSAVEAIKANCSDNEFTQALTAAIPPESLTRGVYSEET    561 - 630
LRARFYAVQKLARRVAMIDETRNSLYQYFLSYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEH    631 - 700
GDLELAAKFVNQLKGESRRVAQDWLKEARMTLETKQIVEILTAYASAVGIGTTQVQPE                701 - 758
//

Text Mined References (47)

PMID Year Title