Property Summary

Ligand Count 7
NCBI Gene PubMed Count 11
PubMed Score 60.68
PubTator Score 51.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 3.7e-03
cystic fibrosis 1.400 7.9e-05
gastric carcinoma 2.300 1.9e-02
glioblastoma 2.000 2.0e-03
group 3 medulloblastoma -1.200 7.4e-03
lung cancer -2.200 3.3e-04
lung carcinoma -1.300 5.7e-13
malignant mesothelioma 1.400 5.0e-06
medulloblastoma, large-cell -2.300 8.0e-06
mucosa-associated lymphoid tissue lympho... 1.151 1.3e-02
oligodendroglioma -1.200 3.9e-02
osteosarcoma -1.990 8.2e-04
ovarian cancer 1.400 2.4e-03
posterior fossa group B ependymoma -1.100 6.1e-03
psoriasis 2.400 2.3e-08
tuberculosis -1.100 2.6e-04

Synonym

Accession Q16831 D3DVM4 Q15362 UPase 1
Symbols UP
UPP
UPASE
UDRPASE

Gene

PANTHER Protein Class (2)

PDB

3EUE   3EUF   3NBQ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (9)

AA Sequence

MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIR      1 - 70
CVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIG     71 - 140
TSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCT    141 - 210
LDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQ    211 - 280
ISSPRNVLSEYQQRPQRLVSYFIKKKLSKA                                            281 - 310
//

Text Mined References (12)

PMID Year Title