Property Summary

NCBI Gene PubMed Count 26
Grant Count 148
R01 Count 94
Funding $10,787,676.62
PubMed Score 164.21
PubTator Score 232.19

Knowledge Summary

Patent (36,032)

Expression

  Differential Expression (9)

Disease log2 FC p
nephrosclerosis -1.498 0.030
malignant mesothelioma 1.300 0.000
osteosarcoma -1.693 0.002
pancreatic ductal adenocarcinoma liver m... -1.261 0.021
group 3 medulloblastoma 2.100 0.000
subependymal giant cell astrocytoma 1.458 0.020
Polycystic Ovary Syndrome -1.197 0.049
ulcerative colitis -1.300 0.000
ovarian cancer 1.200 0.002

Synonym

Accession Q16822 O43253 Q86U01 Q9BV62 PEPCK-M
Symbols PEPCK
PEPCK2
PEPCK-M

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (20)

PMID Text
26556724 ApoA-IV colocalizes with NR4A1, which suppresses G6Pase and PEPCK gene expression at the transcriptional level, reducing hepatic glucose output and lowering blood glucose.
26481663 Results indicate that PEPCK promotes tumor growth by increasing glucose and glutamine metabolism, increases anabolic metabolism and promotes mTORC1 activity.
26474064 Mitochondrial PCK2 regulates metabolic adaptation and enables glucose-independent tumor growth in various neoplasms.
26469385 HIV-1 MA increases PCK2 mRNA expression in HepG2 cells
26036577 When autophagy was blocked, the level of glucose-6-phosphatase (G6Pase) and phosphoenolpyruvate carboxykinase (PEPCK) was reduced in HepG2 cells and not in Hep3B cells.
24973213 Amino acid limitation and ER stress inducers, conditions that activate the amino acid response (AAR) and the unfolded protein response (UPR), stimulate PCK2 gene transcription in tumor cell lines.
24632615 PEPCK activity was elevated threefold in lung cancer samples over normal lungs and its activation mediates an adaptive response to glucose depletion in lung cancer.
24602180 Expression of phosphoenolpyruvate carboxykinase linked to chemoradiation susceptibility of human colon cancer cells.
22955269 expression of HCV nonstructural component NS5A in Huh7 or primary hepatocytes stimulated PEPCK gene expression and glucose output in HepG2 cells.
21733854 results reveal a novel link between glucose metabolism and the DNA damage signaling pathway and suggest a possible role for PEPCK and G6P in the DNA damage response
More...

AA Sequence

MAALYRPGLRLNWHGLSPLGWPSCRSIQTLRVLSGDLGQLPTGIRDFVEHSARLCQPEGIHICDGTEAEN      1 - 70
TATLTLLEQQGLIRKLPKYNNCWLARTDPKDVARVESKTVIVTPSQRDTVQLPPGGARGQLGNWMSPADF     71 - 140
QRAVDERFPGCMQGRTMYVLPFSMGPVGSPLSRIGVQLTDSAYVVASMRIMTRLGTPVLQALGDGDFVKC    141 - 210
LHSVGQPLTGQGEPVSQWPCNPEKTLIGHVPDQREIISFGSGYGGNSLLGKKCFALRIASRLARDEGWLA    211 - 280
EHMLILGITSPAGKKRYVAAAFPSACGKTNLAMMRPALPGWKVECVGDDIAWMRFDSEGRLRAINPENGF    281 - 350
FGVAPGTSATTNPNAMATIQSNTIFTNVAETSDGGVYWEGIDQPLPPGVTVTSWLGKPWKPGDKEPCAHP    351 - 420
NSRFCAPARQCPIMDPAWEAPEGVPIDAIIFGGRRPKGVPLVYEAFNWRHGVFVGSAMRSESTAAAEHKG    421 - 490
KIIMHDPFAMRPFFGYNFGHYLEHWLSMEGRKGAQLPRIFHVNWFRRDEAGHFLWPGFGENARVLDWICR    491 - 560
RLEGEDSARETPIGLVPKEGALDLSGLRAIDTTQLFSLPKDFWEQEVRDIRSYLTEQVNQDLPKEVLAEL    561 - 630
EALERRVHKM                                                                631 - 640
//

Text Mined References (30)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26556724 2015 Interaction of ApoA-IV with NR4A1 and NR1D1 Represses G6Pase and PEPCK Transcription: Nuclear Receptor-Mediated Downregulation of Hepatic Gluconeogenesis in Mice and a Human Hepatocyte Cell Line.
26481663 2015 PEPCK Coordinates the Regulation of Central Carbon Metabolism to Promote Cancer Cell Growth.
26474064 2015 Mitochondrial Phosphoenolpyruvate Carboxykinase Regulates Metabolic Adaptation and Enables Glucose-Independent Tumor Growth.
26036577 2015 The regulation of glucose-6-phosphatase and phosphoenolpyruvate carboxykinase by autophagy in low-glycolytic hepatocellular carcinoma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24973213 2014 Mitochondrial phosphoenolpyruvate carboxykinase (PEPCK-M) is a pro-survival, endoplasmic reticulum (ER) stress response gene involved in tumor cell adaptation to nutrient availability.
24632615 2015 PCK2 activation mediates an adaptive response to glucose depletion in lung cancer.
24602180 2014 Expression of phosphoenolpyruvate carboxykinase linked to chemoradiation susceptibility of human colon cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...