Property Summary

NCBI Gene PubMed Count 36
PubMed Score 33.35
PubTator Score 37.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
colon cancer 1478 1.3e-07
lung carcinoma 2843 1.4e-06
ulcerative colitis 1819 1.0e-03
lung cancer 4740 1.3e-03
active Crohn's disease 922 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Dentin dysplasia 19 3.704 1.9
Dentinogenesis imperfecta 25 3.193 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease -2.964 2.3e-02
colon cancer -2.500 1.3e-07
lung cancer 1.900 1.3e-03
lung carcinoma 1.600 1.4e-06
ulcerative colitis -3.400 1.0e-03

Gene RIF (18)

AA Sequence

MDLWNLSWFLFLDALLVISGLATPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQIRNSIIGEKYR      1 - 70
WPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGETNYISVFKGSGCWSSVGNRRVGKQELSI     71 - 140
GANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRILSGREHNFNTYSDDISDSLNVPYDYTSVMH    141 - 210
YSKTAFQNGTEPTIVTRISDFEDVIGQRMDFSDSDLLKLNQLYNCSSSLSFMDSCSFELENVCGMIQSSG    211 - 280
DNADWQRVSQVPRGPESDHSNMGQCQGSGFFMHFDSSSVNVGATAVLESRTLYPKRGFQCLQFYLYNSGS    281 - 350
ESDQLNIYIREYSADNVDGNLTLVEEIKEIPTGSWQLYHVTLKVTKKFRVVFEGRKGSGASLGGLSIDDI    351 - 420
NLSETRCPHHIWHIRNFTQFIGSPNGTLYSPPFYSSKGYAFQIYLNLAHVTNAGIYFHLISGANDDQLQW    421 - 490
PCPWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTDNGNYFWDRPSKVGTVALFSNGTQFRRGGGYGTS    491 - 560
AFITHERLKSRDFIKGDDVYILLTVEDISHLNSTQIQLTPAPSVQDLCSKTTCKNDGVCTVRDGKAECRC    561 - 630
QSGEDWWYMGERCEKRGSTRDTIVIAVSSTVAVFALMLIITLVSVYCTRKKYRERMSSNRPNLTPQNQHA    631 - 700
F//

Text Mined References (43)

PMID Year Title