Property Summary

NCBI Gene PubMed Count 34
Grant Count 6
R01 Count 2
Funding $256,752.83
PubMed Score 33.36
PubTator Score 37.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -2.500 0.000
lung cancer 1.900 0.001
active Crohn's disease -2.964 0.023
lung carcinoma 1.600 0.000
ulcerative colitis -3.400 0.001

Gene RIF (17)

PMID Text
26251449 Meprin Beta was found to be activated at the cell surface by matriptase-2.
25855967 n conclusion, we show that the concept of cleavable linkers specific for meprin beta is feasible, as the peptides are rapidly cleaved by the enzyme while retaining their biological properties
24474695 Meprin metalloproteases A and B inactivate interleukin 6
24258247 Suggest role for in meprin-beta-Fra2 axis in mediating vascular remodelling in pulmonary hypertension.
24239627 promotes inflammation in macrophages via ADAM-10 dependent pathway
24114056 Overexpression of MEP1B is associated with pancreatic neuroendocrine tumors.
22940918 of the 151 new extracellular substrates identified, it was notable that ADAM10 the constitutive alpha-secretase-is activated by meprin beta through cleavage of the propeptide
22879596 metalloprotease meprin beta generates amino terminal-truncated amyloid beta peptide species
21646356 Processing of APP by meprin beta was subsequently validated using in vitro and in vivo approaches. N-terminal APP fragments of about 11 and 20 kDa were found in human and mouse brain lysates but not in meprin beta(-/-) mouse brain lysates
20953144 Demonstrate that the metalloprotease meprin beta and gamma-ENaC associate directly through cytoplasmic domains.
More...

AA Sequence

MDLWNLSWFLFLDALLVISGLATPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQIRNSIIGEKYR      1 - 70
WPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGETNYISVFKGSGCWSSVGNRRVGKQELSI     71 - 140
GANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRILSGREHNFNTYSDDISDSLNVPYDYTSVMH    141 - 210
YSKTAFQNGTEPTIVTRISDFEDVIGQRMDFSDSDLLKLNQLYNCSSSLSFMDSCSFELENVCGMIQSSG    211 - 280
DNADWQRVSQVPRGPESDHSNMGQCQGSGFFMHFDSSSVNVGATAVLESRTLYPKRGFQCLQFYLYNSGS    281 - 350
ESDQLNIYIREYSADNVDGNLTLVEEIKEIPTGSWQLYHVTLKVTKKFRVVFEGRKGSGASLGGLSIDDI    351 - 420
NLSETRCPHHIWHIRNFTQFIGSPNGTLYSPPFYSSKGYAFQIYLNLAHVTNAGIYFHLISGANDDQLQW    421 - 490
PCPWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTDNGNYFWDRPSKVGTVALFSNGTQFRRGGGYGTS    491 - 560
AFITHERLKSRDFIKGDDVYILLTVEDISHLNSTQIQLTPAPSVQDLCSKTTCKNDGVCTVRDGKAECRC    561 - 630
QSGEDWWYMGERCEKRGSTRDTIVIAVSSTVAVFALMLIITLVSVYCTRKKYRERMSSNRPNLTPQNQHA    631 - 700
F//

Text Mined References (42)

PMID Year Title
26251449 2015 Metalloprotease meprin ? is activated by transmembrane serine protease matriptase-2 at the cell surface thereby enhancing APP shedding.
25855967 2015 Evaluation of ¹¹¹in-labelled exendin-4 derivatives containing different meprin ?-specific cleavable linkers.
24474695 2014 Meprin metalloproteases inactivate interleukin 6.
24258247 2014 Meprin ?, a novel mediator of vascular remodelling underlying pulmonary hypertension.
24239627 2014 Meprin-? regulates production of pro-inflammatory factors via a disintegrin and metalloproteinase-10 (ADAM-10) dependent pathway in macrophages.
24114056 2013 Overexpression of membrane proteins in primary and metastatic gastrointestinal neuroendocrine tumors.
23123160 2012 Meprins process matrix metalloproteinase-9 (MMP-9)/gelatinase B and enhance the activation kinetics by MMP-3.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22988105 2012 Structural basis for the sheddase function of human meprin ? metalloproteinase at the plasma membrane.
22940918 2013 The substrate degradome of meprin metalloproteases reveals an unexpected proteolytic link between meprin ? and ADAM10.
More...