Property Summary

NCBI Gene PubMed Count 34
PubMed Score 33.36
PubTator Score 37.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
colon cancer 1475 1.2786514887911E-7
lung carcinoma 2844 1.38364612723474E-6
ulcerative colitis 2087 0.00100127604074048
lung cancer 4473 0.00128351639037689
active Crohn's disease 918 0.0233257598523007
Disease Target Count Z-score Confidence
Dentin dysplasia 19 3.78 1.9
Dentinogenesis imperfecta 24 3.316 1.7

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer -2.500 0.000
lung cancer 1.900 0.001
active Crohn's disease -2.964 0.023
lung carcinoma 1.600 0.000
ulcerative colitis -3.400 0.001

Synonym

Accession Q16820 B7ZM35 B9EGL6 Q670J1
Symbols

Gene

PDB

4GWM   4GWN  

  Ortholog (13)

Gene RIF (17)

PMID Text
26251449 Meprin Beta was found to be activated at the cell surface by matriptase-2.
25855967 n conclusion, we show that the concept of cleavable linkers specific for meprin beta is feasible, as the peptides are rapidly cleaved by the enzyme while retaining their biological properties
24474695 Meprin metalloproteases A and B inactivate interleukin 6
24258247 Suggest role for in meprin-beta-Fra2 axis in mediating vascular remodelling in pulmonary hypertension.
24239627 promotes inflammation in macrophages via ADAM-10 dependent pathway
24114056 Overexpression of MEP1B is associated with pancreatic neuroendocrine tumors.
22940918 of the 151 new extracellular substrates identified, it was notable that ADAM10 the constitutive alpha-secretase-is activated by meprin beta through cleavage of the propeptide
22879596 metalloprotease meprin beta generates amino terminal-truncated amyloid beta peptide species
21646356 Processing of APP by meprin beta was subsequently validated using in vitro and in vivo approaches. N-terminal APP fragments of about 11 and 20 kDa were found in human and mouse brain lysates but not in meprin beta(-/-) mouse brain lysates
20953144 Demonstrate that the metalloprotease meprin beta and gamma-ENaC associate directly through cytoplasmic domains.
More...

AA Sequence

MDLWNLSWFLFLDALLVISGLATPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQIRNSIIGEKYR      1 - 70
WPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGETNYISVFKGSGCWSSVGNRRVGKQELSI     71 - 140
GANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRILSGREHNFNTYSDDISDSLNVPYDYTSVMH    141 - 210
YSKTAFQNGTEPTIVTRISDFEDVIGQRMDFSDSDLLKLNQLYNCSSSLSFMDSCSFELENVCGMIQSSG    211 - 280
DNADWQRVSQVPRGPESDHSNMGQCQGSGFFMHFDSSSVNVGATAVLESRTLYPKRGFQCLQFYLYNSGS    281 - 350
ESDQLNIYIREYSADNVDGNLTLVEEIKEIPTGSWQLYHVTLKVTKKFRVVFEGRKGSGASLGGLSIDDI    351 - 420
NLSETRCPHHIWHIRNFTQFIGSPNGTLYSPPFYSSKGYAFQIYLNLAHVTNAGIYFHLISGANDDQLQW    421 - 490
PCPWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTDNGNYFWDRPSKVGTVALFSNGTQFRRGGGYGTS    491 - 560
AFITHERLKSRDFIKGDDVYILLTVEDISHLNSTQIQLTPAPSVQDLCSKTTCKNDGVCTVRDGKAECRC    561 - 630
QSGEDWWYMGERCEKRGSTRDTIVIAVSSTVAVFALMLIITLVSVYCTRKKYRERMSSNRPNLTPQNQHA    631 - 700
F//

Text Mined References (42)

PMID Year Title
26251449 2015 Metalloprotease meprin ? is activated by transmembrane serine protease matriptase-2 at the cell surface thereby enhancing APP shedding.
25855967 2015 Evaluation of ¹¹¹in-labelled exendin-4 derivatives containing different meprin ?-specific cleavable linkers.
24474695 2014 Meprin metalloproteases inactivate interleukin 6.
24258247 2014 Meprin ?, a novel mediator of vascular remodelling underlying pulmonary hypertension.
24239627 2014 Meprin-? regulates production of pro-inflammatory factors via a disintegrin and metalloproteinase-10 (ADAM-10) dependent pathway in macrophages.
24114056 2013 Overexpression of membrane proteins in primary and metastatic gastrointestinal neuroendocrine tumors.
23123160 2012 Meprins process matrix metalloproteinase-9 (MMP-9)/gelatinase B and enhance the activation kinetics by MMP-3.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22988105 2012 Structural basis for the sheddase function of human meprin ? metalloproteinase at the plasma membrane.
22940918 2013 The substrate degradome of meprin metalloproteases reveals an unexpected proteolytic link between meprin ? and ADAM10.
More...