Property Summary

NCBI Gene PubMed Count 32
PubMed Score 49.00
PubTator Score 29.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... 2.900 0.026
colon cancer -2.400 0.000
active Crohn's disease -1.441 0.010
ulcerative colitis -2.200 0.000

Synonym

Accession Q16819 A2RRM4 B0AZP9 B2RCS2 Q8TDC9 Q9H1R1
Symbols PPHA

Gene

Gene RIF (13)

PMID Text
24474695 Meprin metalloproteases A and B inactivate interleukin 6
24388959 Variants rs17468190 (G/T) in the MEP1A gene are associated with glucose and insulin metabolism in overweight/obese central European women with polycystic ovary syndrome.
22923609 Proteolytically active meprinalpha leads to an increase in EGFR and ERK1/2 phosphorylation and subsequently enhances cell proliferation and migration
22326557 The present results indicate that a TNF-alpha-mediated down-regulation of CDX2 can be related to suppressed expression of MEP1A during intestinal inflammation.
22096485 Meprin-alpha activity is regulated differently in primary tumors and metastases of colorectal cancer. By virtue of its pro-migratory and pro-angiogenic activity, meprin-alpha may promote tumor progression in colorectal cancer.
20806899 Cystatin C was an inhibitor for human meprin alpha(K(i) = 8.5 x 10(-6) M) but, interestingly, not for meprin beta.
20631730 meprins could be important players in several remodeling processes involving collagen fiber deposition
19262505 MEP1A is a UC susceptibility gene and indicate that decreased meprin-alpha expression is associated with intestinal inflammation in IBD patients and in a mouse experimental model of IBD.
19262505 Observational study of gene-disease association. (HuGE Navigator)
17195012 Mephrin beta induced a dramatic change in cell morphology and reduced the cell number, indicating a function in terminal differentiation, whereas meprin alpha did not affect cell viability, and may play a role in basal keratinocyte proliferation.
More...

AA Sequence

MAWIRSTCILFFTLLFAHIAAVPIKYLPEENVHDADFGEQKDISEINLAAGLDLFQGDILLQKSRNGLRD      1 - 70
PNTRWTFPIPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEGESSYIIFQQFDGCWSEVGDQHVGQN     71 - 140
ISIGQGCAYKAIIEHEILHALGFYHEQSRTDRDDYVNIWWDQILSGYQHNFDTYDDSLITDLNTPYDYES    141 - 210
LMHYQPFSFNKNASVPTITAKIPEFNSIIGQRLDFSAIDLERLNRMYNCTTTHTLLDHCTFEKANICGMI    211 - 280
QGTRDDTDWAHQDSAQAGEVDHTLLGQCTGAGYFMQFSTSSGSAEEAALLESRILYPKRKQQCLQFFYKM    281 - 350
TGSPSDRLVVWVRRDDSTGNVRKLVKVQTFQGDDDHNWKIAHVVLKEEQKFRYLFQGTKGDPQNSTGGIY    351 - 420
LDDITLTETPCPTGVWTVRNFSQVLENTSKGDKLQSPRFYNSEGYGFGVTLYPNSRESSGYLRLAFHVCS    421 - 490
GENDAILEWPVENRQVIITILDQEPDVRNRMSSSMVFTTSKSHTSPAINDTVIWDRPSRVGTYHTDCNCF    491 - 560
RSIDLGWSGFISHQMLKRRSFLKNDDLIIFVDFEDITHLSQTEVPTKGKRLSPQGLILQGQEQQVSEEGS    561 - 630
GKAMLEEALPVSLSQGQPSRQKRSVENTGPLEDHNWPQYFRDPCDPNPCQNDGICVNVKGMASCRCISGH    631 - 700
AFFYTGERCQAVQVHGSVLGMVIGGTAGVIFLTFSIIAILSQRPRK                            701 - 746
//

Text Mined References (36)

PMID Year Title
24474695 2014 Meprin metalloproteases inactivate interleukin 6.
24388959 2014 Association of MEP1A gene variants with insulin metabolism in central European women with polycystic ovary syndrome.
23123160 2012 Meprins process matrix metalloproteinase-9 (MMP-9)/gelatinase B and enhance the activation kinetics by MMP-3.
22923609 2012 Meprin? transactivates the epidermal growth factor receptor (EGFR) via ligand shedding, thereby enhancing colorectal cancer cell proliferation and migration.
22326557 2012 TNF-?-induced down-regulation of CDX2 suppresses MEP1A expression in colitis.
22096485 2011 Enhanced activity of meprin-?, a pro-migratory and pro-angiogenic protease, in colorectal cancer.
20806899 2010 Fetuin-A and cystatin C are endogenous inhibitors of human meprin metalloproteases.
20631730 2010 Processing of procollagen III by meprins: new players in extracellular matrix assembly?
19262505 2009 MEP1A allele for meprin A metalloprotease is a susceptibility gene for inflammatory bowel disease.
17976009 2007 Human and mouse homo-oligomeric meprin A metalloendopeptidase: substrate and inhibitor specificities.
More...