Property Summary

NCBI Gene PubMed Count 33
PubMed Score 52.99
PubTator Score 29.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Colonic Neoplasms 142 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Dentin dysplasia 19 3.305 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease -1.441 1.0e-02
colon cancer -1.300 2.2e-02
intraductal papillary-mucinous carcinoma... 2.900 2.6e-02
ulcerative colitis -2.200 4.2e-06

Gene RIF (14)

AA Sequence

MAWIRSTCILFFTLLFAHIAAVPIKYLPEENVHDADFGEQKDISEINLAAGLDLFQGDILLQKSRNGLRD      1 - 70
PNTRWTFPIPYILADNLGLNAKGAILYAFEMFRLKSCVDFKPYEGESSYIIFQQFDGCWSEVGDQHVGQN     71 - 140
ISIGQGCAYKAIIEHEILHALGFYHEQSRTDRDDYVNIWWDQILSGYQHNFDTYDDSLITDLNTPYDYES    141 - 210
LMHYQPFSFNKNASVPTITAKIPEFNSIIGQRLDFSAIDLERLNRMYNCTTTHTLLDHCTFEKANICGMI    211 - 280
QGTRDDTDWAHQDSAQAGEVDHTLLGQCTGAGYFMQFSTSSGSAEEAALLESRILYPKRKQQCLQFFYKM    281 - 350
TGSPSDRLVVWVRRDDSTGNVRKLVKVQTFQGDDDHNWKIAHVVLKEEQKFRYLFQGTKGDPQNSTGGIY    351 - 420
LDDITLTETPCPTGVWTVRNFSQVLENTSKGDKLQSPRFYNSEGYGFGVTLYPNSRESSGYLRLAFHVCS    421 - 490
GENDAILEWPVENRQVIITILDQEPDVRNRMSSSMVFTTSKSHTSPAINDTVIWDRPSRVGTYHTDCNCF    491 - 560
RSIDLGWSGFISHQMLKRRSFLKNDDLIIFVDFEDITHLSQTEVPTKGKRLSPQGLILQGQEQQVSEEGS    561 - 630
GKAMLEEALPVSLSQGQPSRQKRSVENTGPLEDHNWPQYFRDPCDPNPCQNDGICVNVKGMASCRCISGH    631 - 700
AFFYTGERCQAVQVHGSVLGMVIGGTAGVIFLTFSIIAILSQRPRK                            701 - 746
//

Text Mined References (37)

PMID Year Title