Property Summary

NCBI Gene PubMed Count 40
Grant Count 11
R01 Count 11
Funding $1,090,455.5
PubMed Score 27.79
PubTator Score 28.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Gene RIF (15)

PMID Text
26739891 RTN1A is a key mediator for proteinuria-induced tubular cell toxicity and renal fibrosis.
26496126 Results suggest evidence of genetic association between common variants in RTN1 and end-stage kidney disease in African-Americans and European-Americans.
26227493 RTN1A contributes to progression of kidney disease by inducing ER stress.
25573430 RTN-1C involvement in the regulation of Endoplasmic reticulum-mitochondria cross-talk, defines a role for RTN-1C in maintaining the function of contacts between the two organelles.
25543119 MANF is a protein that interacts with RTN1-C
23559015 RTN1-C induces PDI redistribution in endoplasmic reticulum vesicles, and concomitantly modulates its activity by decreasing the levels of its S-nitrosylated form.
22522967 In the present study a potential metal ion binding motif (HxE/D) at the C-terminal of the RTN1-C has been identified and its capability to bind metals investigated by UV-vis, CD, multidimensional NMR spectroscopy and biological assays.
20708685 RTN-1C is able to specifically regulate gene expression, modulating transcript clusters which have been implicated in the onset of neurodegenerative disorders
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19668229 RTN-1C protein binds to DNA and that its biological function is regulated by acetylation and is coupled to the inhibition of HDAC activity.
More...

AA Sequence

MAAPGDPQDELLPLAGPGSQWLRHRGEGENEAVTPKGATPAPQAGEPSPGLGARAREAASREAGSGPARQ      1 - 70
SPVAMETASTGVAGVSSAMDHTFSTTSKDGEGSCYTSLISDICYPPQEDSTYFTGILQKENGHVTISESP     71 - 140
EELGTPGPSLPDVPGIESRGLFSSDSGIEMTPAESTEVNKILADPLDQMKAEAYKYIDITRPEEVKHQEQ    141 - 210
HHPELEDKDLDFKNKDTDISIKPEGVREPDKPAPVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTP    211 - 280
VKITLTEIEPSVETTTQEKTPEKQDICLKPSPDTVPTVTVSEPEDDSPGSITPPSSGTEPSAAESQGKGS    281 - 350
ISEDELITAIKEAKGLSYETAENPRPVGQLADRPEVKARSGPPTIPSPLDHEASSAESGDSEIELVSEDP    351 - 420
MAAEDALPSGYVSFGHVGGPPPSPASPSIQYSILREEREAELDSELIIESCDASSASEESPKREQDSPPM    421 - 490
KPSALDAIREETGVRAEERAPSRRGLAEPGSFLDYPSTEPQPGPELPPGDGALEPETPMLPRKPEEDSSS    491 - 560
NQSPAATKGPGPLGPGAPPPLLFLNKQKAIDLLYWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALA    561 - 630
ALSATISFRIYKSVLQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLV    631 - 700
DSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPG    701 - 770
AKRHAE                                                                    771 - 776
//

Text Mined References (43)

PMID Year Title
26739891 2016 Knockdown of RTN1A attenuates ER stress and kidney injury in albumin overload-induced nephropathy.
26496126 2015 Association Analysis of the Reticulon 1 Gene in End-Stage Kidney Disease.
26227493 2015 RTN1 mediates progression of kidney disease by inducing ER stress.
25612671 2014 Identification and characterization of TMEM33 as a reticulon-binding protein.
25573430 2015 Reticulon protein-1C is a key component of MAMs.
25543119 2015 Identification of MANF as a protein interacting with RTN1-C.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23559015 2013 Reticulon1-C modulates protein disulphide isomerase function.
22522967 2012 A metal-binding site in the RTN1-C protein: new perspectives on the physiological role of a neuronal protein.
More...