Property Summary

NCBI Gene PubMed Count 41
PubMed Score 29.77
PubTator Score 28.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
lung cancer -1.500 3.8e-03
adult high grade glioma -2.300 4.2e-05
aldosterone-producing adenoma -1.415 1.7e-02
astrocytoma -1.100 1.0e-08
Astrocytoma, Pilocytic -1.400 8.9e-05
Atopic dermatitis -1.100 2.9e-02
atypical teratoid / rhabdoid tumor -3.800 9.4e-05
Breast cancer -1.700 5.1e-03
colon cancer -3.100 1.2e-03
ependymoma -1.300 3.7e-02
facioscapulohumeral dystrophy -1.800 2.3e-02
glioblastoma -1.800 1.5e-04
interstitial cystitis 1.800 8.7e-03
intraductal papillary-mucinous adenoma (... -2.600 2.8e-03
intraductal papillary-mucinous carcinoma... -3.000 1.8e-03
intraductal papillary-mucinous neoplasm ... -2.000 4.9e-02
invasive ductal carcinoma -1.500 7.7e-03
lung adenocarcinoma -1.374 1.0e-03
malignant mesothelioma -5.300 5.1e-09
medulloblastoma, large-cell -1.500 1.1e-04
non-small cell lung cancer -1.756 2.5e-14
oligodendroglioma -1.100 4.2e-05
ovarian cancer -5.300 1.2e-15
Pick disease -2.300 2.5e-03
primary Sjogren syndrome 1.700 1.3e-04
psoriasis -1.600 8.4e-08
sarcoidosis 1.100 4.7e-02
subependymal giant cell astrocytoma -3.636 3.5e-02
tuberculosis 3.900 6.4e-09

Gene RIF (16)

AA Sequence

MAAPGDPQDELLPLAGPGSQWLRHRGEGENEAVTPKGATPAPQAGEPSPGLGARAREAASREAGSGPARQ      1 - 70
SPVAMETASTGVAGVSSAMDHTFSTTSKDGEGSCYTSLISDICYPPQEDSTYFTGILQKENGHVTISESP     71 - 140
EELGTPGPSLPDVPGIESRGLFSSDSGIEMTPAESTEVNKILADPLDQMKAEAYKYIDITRPEEVKHQEQ    141 - 210
HHPELEDKDLDFKNKDTDISIKPEGVREPDKPAPVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTP    211 - 280
VKITLTEIEPSVETTTQEKTPEKQDICLKPSPDTVPTVTVSEPEDDSPGSITPPSSGTEPSAAESQGKGS    281 - 350
ISEDELITAIKEAKGLSYETAENPRPVGQLADRPEVKARSGPPTIPSPLDHEASSAESGDSEIELVSEDP    351 - 420
MAAEDALPSGYVSFGHVGGPPPSPASPSIQYSILREEREAELDSELIIESCDASSASEESPKREQDSPPM    421 - 490
KPSALDAIREETGVRAEERAPSRRGLAEPGSFLDYPSTEPQPGPELPPGDGALEPETPMLPRKPEEDSSS    491 - 560
NQSPAATKGPGPLGPGAPPPLLFLNKQKAIDLLYWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALA    561 - 630
ALSATISFRIYKSVLQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLV    631 - 700
DSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPG    701 - 770
AKRHAE                                                                    771 - 776
//

Text Mined References (44)

PMID Year Title