Property Summary

NCBI Gene PubMed Count 14
Grant Count 32
R01 Count 20
Funding $8,282,676.29
PubMed Score 172.62
PubTator Score 50.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -2.080 0.000
ependymoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
primitive neuroectodermal tumor -1.500 0.025
pancreatic ductal adenocarcinoma liver m... 1.056 0.011
non-small cell lung cancer -1.203 0.000
colon cancer -1.200 0.022
lung cancer -1.200 0.004
inflammatory breast cancer -1.400 0.004
Pick disease -1.400 0.000
invasive ductal carcinoma -1.400 0.013
ulcerative colitis -1.100 0.000

Gene RIF (7)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19416979 human c-NADP-ME exists mainly as a tetramer, whereas human m-NAD(P)-ME exists as a mixture of dimers and tetramers
19236308 Studies demonstrate that the Lys57 residue plays dual functional roles in the structural integrity of the allosteric site and in the subunit-subunit interaction at the dimer interface of m-NAD(P)-ME.
18959763 ATP inhibition is proposed to be determined by the electrostatic potential involving the positive charge on the side chain of Lys346

AA Sequence

MGAALGTGTRLAPWPGRACGALPRWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLNKGMAFTLEER      1 - 70
LQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPT     71 - 140
VGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNIKAVVVTDGERILGLGDLGCYGMGIPVGKLA    141 - 210
LYTACGGVNPQQCLPVLLDVGTNNEELLRDPLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGINCLIQFE    211 - 280
DFANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVM    281 - 350
ALEKEGVPKAEATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGA    351 - 420
FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKSVTLEDGKTFIPGQGNNA    421 - 490
YVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHN    491 - 560
LASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV                              561 - 604
//

Text Mined References (16)

PMID Year Title
24025145 2013 A genome-wide association study of chemotherapy-induced alopecia in breast cancer patients.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19416979 2009 Functional roles of the tetramer organization of malic enzyme.
19236308 2009 Dual roles of Lys(57) at the dimer interface of human mitochondrial NAD(P)+-dependent malic enzyme.
18959763 2008 Influential factor contributing to the isoform-specific inhibition by ATP of human mitochondrial NAD(P)+-dependent malic enzyme: functional roles of the nucleotide binding site Lys346.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
More...