Property Summary

NCBI Gene PubMed Count 14
PubMed Score 182.19
PubTator Score 50.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.600 3.9e-06
colon cancer -1.200 2.2e-02
ependymoma -1.200 4.2e-08
inflammatory breast cancer -1.400 4.0e-03
invasive ductal carcinoma -1.400 1.3e-02
lung cancer -1.100 4.2e-02
non-small cell lung cancer -1.203 1.3e-08
osteosarcoma -2.080 5.2e-05
pancreatic ductal adenocarcinoma liver m... 1.056 1.1e-02
Pick disease -1.400 3.8e-05
primitive neuroectodermal tumor -1.500 2.5e-02
ulcerative colitis -1.100 1.9e-05

 MGI Phenotype (1)

Gene RIF (7)

AA Sequence

MGAALGTGTRLAPWPGRACGALPRWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLNKGMAFTLEER      1 - 70
LQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPT     71 - 140
VGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNIKAVVVTDGERILGLGDLGCYGMGIPVGKLA    141 - 210
LYTACGGVNPQQCLPVLLDVGTNNEELLRDPLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGINCLIQFE    211 - 280
DFANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVM    281 - 350
ALEKEGVPKAEATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGA    351 - 420
FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKSVTLEDGKTFIPGQGNNA    421 - 490
YVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHN    491 - 560
LASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV                              561 - 604
//

Text Mined References (16)

PMID Year Title