Property Summary

NCBI Gene PubMed Count 22
PubMed Score 471.02
PubTator Score 107.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.184 4.4e-03
ovarian cancer 1.300 1.9e-04
psoriasis 1.100 1.0e-03

 OMIM Phenotype (1)

Gene RIF (13)

AA Sequence

MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGE      1 - 70
RAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYIL     71 - 140
NPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYA    141 - 210
KHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST       211 - 277
//

Text Mined References (28)

PMID Year Title