Property Summary

NCBI Gene PubMed Count 29
PubMed Score 331.95
PubTator Score 43.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.800 5.4e-06
astrocytic glioma -1.400 2.5e-03
Astrocytoma, Pilocytic -2.000 4.5e-10
atypical teratoid / rhabdoid tumor -1.700 1.1e-08
ependymoma -1.500 2.2e-03
glioblastoma -1.900 8.6e-12
group 3 medulloblastoma -1.400 7.9e-03
medulloblastoma, large-cell -1.300 3.5e-04
oligodendroglioma -1.100 2.4e-02
ovarian cancer 1.400 1.1e-07
primitive neuroectodermal tumor -1.600 1.7e-04
psoriasis -2.200 2.9e-18
subependymal giant cell astrocytoma -2.534 9.4e-03

Gene RIF (11)

AA Sequence

MGDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEG      1 - 70
LADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNV     71 - 140
SGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAA    141 - 210
LVVGDIAQVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVG    211 - 280
VNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKA    281 - 350
NAPKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFVIETFVVEGRTWLAECTPVYVQYFVKFFII    351 - 420
GVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYL    421 - 490
GDTHYKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFVLDLKRDFQP    491 - 560
VREQIPEDKLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDM    561 - 630
VRKIIEPMACDGLRTICIAYRDFSAGQEPDWDNENEVVGDLTCIAVVGIEDPVRPEVPEAIRKCQRAGIT    631 - 700
VRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGKEFNRRIRNEKGEIEQERLDKVWPKLRVLARSSPTDK    701 - 770
HTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVM    771 - 840
WGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLL    841 - 910
RKPYGRDKPLISRTMMKNILGHAVYQLAIIFTLLFVGELFFDIDSGRNAPLHSPPSEHYTIIFNTFVMMQ    911 - 980
LFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLSTEQWLWCLFVGVGELV    981 - 1050
WGQVIATIPTSQLKCLKEAGHGPGKDEMTDEELAEGEEEIDHAERELRRGQILWFRGLNRIQTQIRVVKA   1051 - 1120
FRSSLYEGLEKPESKTSIHNFMATPEFLINDYTHNIPLIDDTDVDENEERLRAPPPPSPNQNNNAIDSGI   1121 - 1190
YLTTHVTKSATSSVFSSSPGSPLHSVETSL                                           1191 - 1220
//

Text Mined References (30)

PMID Year Title