Property Summary

NCBI Gene PubMed Count 51
PubMed Score 65.97
PubTator Score 20.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
hepatocellular carcinoma 547 4.42 2.2

Gene RIF (26)

AA Sequence

MKVSVAALSCLMLVAVLGSQAQFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSY      1 - 70
FETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI                                71 - 113
//

Text Mined References (52)

PMID Year Title