Property Summary

NCBI Gene PubMed Count 49
Grant Count 2
Funding $224,270
PubMed Score 66.51
PubTator Score 20.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
hepatocellular carcinoma 532 4.323 2.2

Synonym

Accession Q16663 B2RU34 E1P651 Q9UM74
Symbols LKN1
NCC3
SY15
HCC-2
LKN-1
MIP-5
NCC-3
SCYL3
MIP-1D
MRP-2B
SCYA15
HMRP-2B
MIP-1 delta

Gene

 Grant Application (2)

PDB

2HCC  

Gene RIF (24)

PMID Text
26875556 follicular thyroid carcinoma (FTC) might induce tumor associated macrophages (TAMs) infiltration by producing CCL15. Measurement of TAMs and CCL15 in follicular thyroid lesions may be applied clinically to differentiate FTC from follicular adenoma
26341919 Loss of SMAD4 was significantly associated with CCL15 expression.
25579056 two inflammatory cytokines, MIP-1delta and MIP-3alpha, are able to increase mesenchymal stromal cells migration in vitro
23690481 we investigated a role of CCL15 in upregulating ICAM-1 in endothelial cells
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of chemokine (C-C motif) ligand 15 (CCL15) in peptide-treated PBMCs
22279551 Data show that Only three of these proteins EGF, PDGF-BB and MIP-1delta (CCL15) differed significantly in plasma between controls and Alzheimer's disease (AD).
22092970 CCL15 is elevated in human asthma and correlates with disease severity .
20503287 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MKVSVAALSCLMLVAVLGSQAQFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSY      1 - 70
FETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI                                71 - 113
//

Text Mined References (50)

PMID Year Title
26875556 2016 Follicular thyroid carcinoma but not adenoma recruits tumor-associated macrophages by releasing CCL15.
26341919 2016 Loss of SMAD4 Promotes Colorectal Cancer Progression by Accumulation of Myeloid-Derived Suppressor Cells through the CCL15-CCR1 Chemokine Axis.
25579056 2015 Inflammatory Chemokines MIP-1? and MIP-3? Are Involved in the Migration of Multipotent Mesenchymal Stromal Cells Induced by Hepatoma Cells.
23690481 2013 Enhancement of CCL15 expression and monocyte adhesion to endothelial cells (ECs) after hypoxia/reoxygenation and induction of ICAM-1 expression by CCL15 via the JAK2/STAT3 pathway in ECs.
22279551 2012 Evaluation of a previously suggested plasma biomarker panel to identify Alzheimer's disease.
22147696 2012 Biochemical analysis of matrix metalloproteinase activation of chemokines CCL15 and CCL23 and increased glycosaminoglycan binding of CCL16.
22092970 2012 Expression and regulation of CCL15 by human airway smooth muscle cells.
20616008 2010 Inactivation of chemokine (C-C motif) receptor 1 (CCR1) suppresses colon cancer liver metastasis by blocking accumulation of immature myeloid cells in a mouse model.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...