Property Summary

NCBI Gene PubMed Count 54
Grant Count 35
R01 Count 13
Funding $1,988,720.1
PubMed Score 887.00
PubTator Score 293.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
cutaneous lupus erythematosus -3.400 0.005
psoriasis -1.100 0.030

Gene RIF (51)

PMID Text
27062658 Report automated quantification of proliferation with automated hot-spot selection in phosphohistone H3/MART1 dual-stained stage I/II melanoma.
25602697 Suggest MelanA-negative spindle-cell associated melanoma constitutes a distinct inflammatory phenotype correlated with dense infiltration of CD163 macrophages and loss of E-cadherin.
25495780 Knockdown of T-bet expression in Mart-127-35 -specific T-cell-receptor-engineered human CD4(+) CD25(-) and CD8(+) T cells attenuates effector function.
25329118 Inhibin alpha-subunit, Melan A and MNF116 were not sensitive for pheochromocytomas.
25043574 the presence of antibody and T-cell immune responses directed against the melanocyte-differentiation-antigens MART-1 (Melan-A), tyrosinase and gp100 in patients with melanoma-associated leucoderma, as compared to patients with vitiligo.
24846220 Misinitiation of intrathymic MART-1 transcription and biased TCR usage explain the high frequency of MART-1-specific T cells.
24394300 Melan-A was useful to confirm the diagnosis of lentigo maligna in early lesions and to differentiate these from chronically sun-damaged skin.
23899062 Comprehensive characterization of the marginal and joint distributions for S100, HMB-45, and Melan-A across a large series of cutaneous melanomas revealed diversity of expression across this group of antigens.
22925930 In this study, production of the C terminus of the Melan-A(26-35) epitope requires cleavage within a hydrophobic stretch, after V35. Hence, the standard proteasome is the only proteasome able to produce the C terminus of this epitope.
22820661 melan A (A103) is not expressed in mesotheliomas
More...

AA Sequence

MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQCAL      1 - 70
TRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP                           71 - 118
//

Text Mined References (57)

PMID Year Title
27062658 2016 Automated quantification of proliferation with automated hot-spot selection in phosphohistone H3/MART1 dual-stained stage I/II melanoma.
25602697 2015 MelanA-negative spindle-cell associated melanoma, a distinct inflammatory phenotype correlated with dense infiltration of CD163 macrophages and loss of E-cadherin.
25495780 2015 Knockdown of T-bet expression in Mart-127-35 -specific T-cell-receptor-engineered human CD4(+)  CD25(-) and CD8(+) T cells attenuates effector function.
25329118 2014 Inhibin alpha-subunit, Melan A and MNF116 in pheochromocytomas.
25043574 2014 The antibody response against MART-1 differs in patients with melanoma-associated leucoderma and vitiligo.
24846220 2014 Misinitiation of intrathymic MART-1 transcription and biased TCR usage explain the high frequency of MART-1-specific T cells.
24394300 2014 Evaluation of the role of routine melan-A immunohistochemistry for exclusion of microinvasion in 120 cases of lentigo maligna.
23899062 2013 Marginal and joint distributions of S100, HMB-45, and Melan-A across a large series of cutaneous melanomas.
22925930 2012 Analysis of the processing of seven human tumor antigens by intermediate proteasomes.
22820661 2013 Melan A (A103) is not a marker of mesothelioma.
More...