Property Summary

NCBI Gene PubMed Count 55
PubMed Score 931.69
PubTator Score 293.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
cutaneous lupus erythematosus 1057 5.0e-03
psoriasis 6694 3.0e-02
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 3.0

Expression

  Differential Expression (2)

Disease log2 FC p
cutaneous lupus erythematosus -3.400 5.0e-03
psoriasis -1.100 3.0e-02

Gene RIF (52)

AA Sequence

MPREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQCAL      1 - 70
TRRCPQEGFDHRDSKVSLQEKNCEPVVPNAPPAYEKLSAEQSPPPYSP                           71 - 118
//

Text Mined References (58)

PMID Year Title