Property Summary

NCBI Gene PubMed Count 65
PubMed Score 151.97
PubTator Score 31.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 2.1e-05
group 3 medulloblastoma 1.700 9.2e-04
intraductal papillary-mucinous adenoma (... -1.300 3.0e-04
lung cancer 1.900 1.3e-04
medulloblastoma, large-cell 1.900 1.8e-06
osteosarcoma 1.443 8.8e-04
ovarian cancer 1.900 2.9e-05
primitive neuroectodermal tumor 1.200 7.0e-05
psoriasis -1.300 7.8e-06

Protein-protein Interaction (6)

Gene RIF (32)

AA Sequence

MAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFENQKVMYGFCSV      1 - 70
KDSQAALPKYVLINWVGEDVPDARKCACASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARL     71 - 140
SSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEEERKKALDERLRFEQER    141 - 210
MEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAA    211 - 280
AIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRMAPTPIPTRSPSDSSTASTPVAE    281 - 350
QIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAED    351 - 420
LMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQ    421 - 490
GEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAAPQTP    491 - 560
TLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQEEEFAQSEELCAKAPPPVFYNKPPEIDI    561 - 630
TCWDADPVPEEEEGFEGGD                                                       631 - 649
//

Text Mined References (78)

PMID Year Title