Property Summary

NCBI Gene PubMed Count 51
Grant Count 44
R01 Count 31
Funding $2,899,623.8
PubMed Score 126.47
PubTator Score 31.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.400 0.002
osteosarcoma 1.443 0.001
group 4 medulloblastoma 2.300 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.900 0.000
primitive neuroectodermal tumor 1.200 0.000
intraductal papillary-mucinous adenoma (... -1.300 0.000
lung cancer 1.900 0.000
ovarian cancer 1.900 0.000

Pathway (1)

Gene RIF (23)

PMID Text
26123582 Exploring the relationship between drebrin and cognitive function may provide insight into the early prevention of cognitive impairment and in the diagnosis and treatment of Alzheimer's disease.
25839164 Drebrin is critical for progranulin-dependent activation of the Akt and MAPK pathways and modulates motility, invasion and anchorage-independent growth in bladder neoplasms.
25496916 Drebrin 1 (DBN1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24610677 The study compared the proteome profiles of the human colon adenocarcinoma cell line HCT-116 with its metastatic derivative E1. DBN1 was found to be overexpressed in E1 as compared to HCT-116 cells.
24399445 Rab8a and Drebrin E act as key proteins in the regulation of apical trafficking in intestinal epithelial cells.
24346822 In basal cell carcinoma tissues, intense and homogeneous drebrin expression was observed mainly at tumor cell-cell boundaries. In contrast, drebrin was stained only weakly and non-homogeneously in trichoblastoma and trichoepthelioma tissue samples.
23979715 These findings show that drebrin contains a cryptic F-actin-bundling activity regulated by phosphorylation and provide a mechanistic model for microtubule-F-actin coupling.
23926103 drebrin has a role in HIV infection by modulating viral entry, mainly through the control of actin cytoskeleton polymerization in response to HIV-1
23926103 Drebrin 1 (DBN1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23926103 Drebrin 1 (DBN1) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
More...

AA Sequence

MAGVSFSGHRLELLAAYEEVIREESAADWALYTYEDGSDDLKLAASGEGGLQELSGHFENQKVMYGFCSV      1 - 70
KDSQAALPKYVLINWVGEDVPDARKCACASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARL     71 - 140
SSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEEERKKALDERLRFEQER    141 - 210
MEQERQEQEERERRYREREQQIEEHRRKQQTLEAEEAKRRLKEQSIFGDHRDEEEETHMKKSESEVEEAA    211 - 280
AIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRMAPTPIPTRSPSDSSTASTPVAE    281 - 350
QIERALDEVTSSQPPPLPPPPPPAQETQEPSPILDSEETRAAAPQAWAGPMEEPPQAQAPPRGPGSPAED    351 - 420
LMFMESAEQAVLAAPVEPATADATEIHDAADTIETDTATADTTVANNVPPAATSLIDLWPGNGEGASTLQ    421 - 490
GEPRAPTPPSGTEVTLAEVPLLDEVAPEPLLPAGEGCATLLNFDELPEPPATFCDPEEVEGESLAAPQTP    491 - 560
TLPSALEELEQEQEPEPHLLTNGETTQKEGTQASEGYFSQSQEEEFAQSEELCAKAPPPVFYNKPPEIDI    561 - 630
TCWDADPVPEEEEGFEGGD                                                       631 - 649
//

Text Mined References (64)

PMID Year Title
26123582 2015 Drebrin and cognitive impairment.
25839164 2015 A novel role for drebrin in regulating progranulin bioactivity in bladder cancer.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24610677 2014 iTRAQ analysis of colorectal cancer cell lines suggests Drebrin (DBN1) is overexpressed during liver metastasis.
24399445 2014 Drebrin E depletion in human intestinal epithelial cells mimics Rab8a loss of function.
24346822 2014 Expression of drebrin, an actin binding protein, in basal cell carcinoma, trichoblastoma and trichoepithelioma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979715 2013 Drebrin contains a cryptic F-actin-bundling activity regulated by Cdk5 phosphorylation.
23940795 2013 Phosphorylation of the actin binding protein Drebrin at S647 is regulated by neuronal activity and PTEN.
More...