Property Summary

NCBI Gene PubMed Count 184
PubMed Score 495.96
PubTator Score 300.79

Knowledge Summary

Patent

No data available

Expression

Pathway (1)

Gene RIF (118)

AA Sequence

MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTP      1 - 70
KRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSD     71 - 140
LLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKP    141 - 210
GLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGF    211 - 280
RQNQKEGRCSHSLN                                                            281 - 294
//

Text Mined References (207)

PMID Year Title