Property Summary

Ligand Count 33
NCBI Gene PubMed Count 51
PubMed Score 138.31
PubTator Score 67.82

Knowledge Summary

Patent (10,879)

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytoma 1.700 6.0e-03
Astrocytoma, Pilocytic 1.200 5.7e-05
cutaneous lupus erythematosus 2.300 1.2e-03
glioblastoma 1.900 1.1e-03
group 3 medulloblastoma -1.200 1.6e-02
hepatocellular carcinoma 1.500 3.0e-04
interstitial cystitis 1.400 1.7e-03
intraductal papillary-mucinous adenoma (... -1.300 1.6e-02
intraductal papillary-mucinous carcinoma... -1.200 2.9e-02
invasive ductal carcinoma 1.598 8.7e-05
lung cancer -1.900 2.9e-04
lung carcinoma -2.600 2.1e-16
malignant mesothelioma -2.900 1.7e-06
medulloblastoma, large-cell -2.000 3.0e-06
mucosa-associated lymphoid tissue lympho... 2.735 1.6e-02
non-small cell lung cancer -1.015 2.2e-07
osteosarcoma -1.768 4.2e-03
ovarian cancer -2.100 3.3e-07
subependymal giant cell astrocytoma 1.843 2.3e-02
tuberculosis -1.900 2.7e-03
ulcerative colitis 1.200 1.4e-03

Gene RIF (31)

AA Sequence

MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLL      1 - 70
CCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMAC     71 - 140
SICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDR    141 - 210
LDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHET    211 - 280
SPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSV    281 - 350
IMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVC    351 - 420
IALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV            421 - 482
//

Text Mined References (52)

PMID Year Title