Property Summary

NCBI Gene PubMed Count 50
Grant Count 115
R01 Count 92
Funding $8,343,302.56
PubMed Score 127.62
PubTator Score 67.82

Knowledge Summary

Patent (10,879)

Expression

Synonym

Accession Q16581 O43771 Q92868 C3AR
Symbols AZ3B
C3AR
HNFAG09

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (30)

PMID Text
26116899 HIV-1 Vpr upregulates the gene expression of C3AR1 in human monocyte-derived dendritic cells
25603857 Medulloblastoma cells express C3aR, and siRNA-mediated knockdown of C3aR inhibits proliferation of these cells in vitro.
25544179 Observed a positive correlation between the expression of anaphylatoxin-receptors C3aR and C5aR with platelet activation in patients with coronary artery disease.
25465103 these findings suggest a critical role for C3a through autocrine/paracrine induction of C3aR in the pathogenesis of cigarette smoke-induced sterile inflammation and provide new therapeutic targets for the treatment of emphysema.
25426664 High C3aR1 expression is associated with acute myeloid leukemia-M2.
24743347 The obesity-induced down-regulation of complement C3 and C3aR which is specific to subcutaneous adipose tissue.
24327134 In patients with IgAN, urinary and renal C3a and C5a and renal expression of C3aR and C5aR are significantly correlated with the activity and severity of renal injury.
24321396 C3aR and CD46 activation via intrinsic generation of their respective ligands is an integral part of human Th1 (but not Th2) immunity.
23284683 functional regulation of C3aR by NHERFs in human mast cells
23077507 study demonstrates that although C3a causes phosphorylation of its receptor at multiple sites, Ser459, Thr463, Ser465, Thr466 and Ser470 participate in C3aR desensitization
More...

AA Sequence

MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLL      1 - 70
CCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMAC     71 - 140
SICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDR    141 - 210
LDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHET    211 - 280
SPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSV    281 - 350
IMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVC    351 - 420
IALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV            421 - 482
//

Text Mined References (51)

PMID Year Title
25603857 2015 Tumor necrosis-initiated complement activation stimulates proliferation of medulloblastoma cells.
25544179 2015 Expression of anaphylatoxin receptors on platelets in patients with coronary heart disease.
25465103 2015 Activation of C3a receptor is required in cigarette smoke-mediated emphysema.
25456411 2014 The TLQP-21 peptide activates the G-protein-coupled receptor C3aR1 via a folding-upon-binding mechanism.
25426664 2015 C3aR1 gene overexpressed at initial stage of acute myeloid leukemia-M2 predicting short-term survival.
24743347 2014 Downregulation of complement C3 and C3aR expression in subcutaneous adipose tissue in obese women.
24327134 2014 C3a, C5a renal expression and their receptors are correlated to severity of IgA nephropathy.
24321396 2014 Human complement C3 deficiency: Th1 induction requires T cell-derived complement C3a and CD46 activation.
23284683 2012 Roles for NHERF1 and NHERF2 on the regulation of C3a receptor signaling in human mast cells.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
More...