Property Summary

NCBI Gene PubMed Count 14
PubMed Score 14.92
PubTator Score 7.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.135 0.001
atypical teratoid / rhabdoid tumor 1.300 0.016
medulloblastoma, large-cell 1.800 0.000
ovarian cancer 1.500 0.000

Gene RIF (3)

PMID Text
24086757 the expression control of Tal2 in hematopoietic cells
21971700 low expression of TAL2 and EGF was observed in human epithelial ovarian cancer
12567187 Activation of the TAL2 gene in T-ALL.

AA Sequence

MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAA      1 - 70
QGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP                                     71 - 108
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24086757 2013 The T-cell oncogene Tal2 Is a Target of PU.1 and upregulated during osteoclastogenesis.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21971700 2012 Correlations among ERCC1, XPB, UBE2I, EGF, TAL2 and ILF3 revealed by gene signatures of histological subtypes of patients with epithelial ovarian cancer.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
19448620 2009 Meta-analysis of genome-wide association data identifies two loci influencing age at menarche.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12567187 2003 Distinct t(7;9)(q34;q32) breakpoints in healthy individuals and individuals with T-ALL.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...