Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.97
PubTator Score 7.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Precursor Cell Lymphoblastic Leukemia-Lymphoma 49 0.0 0.0
Disease Target Count
acute lymphocytic leukemia 33
Disease Target Count P-value
ovarian cancer 8520 2.6e-07
medulloblastoma, large-cell 6241 1.1e-05
osteosarcoma 7950 5.0e-04
atypical teratoid / rhabdoid tumor 5112 1.6e-02
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.1
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Embryonal carcinoma 10 3.037 1.5
Disease Target Count
ALL 9

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.6e-02
medulloblastoma, large-cell 1.800 1.1e-05
osteosarcoma 1.135 5.0e-04
ovarian cancer 1.100 2.6e-07

Gene RIF (3)

AA Sequence

MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAA      1 - 70
QGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP                                     71 - 108
//

Text Mined References (14)

PMID Year Title