Property Summary

NCBI Gene PubMed Count 104
Grant Count 101
R01 Count 75
Funding $8,990,389.13
PubMed Score 191.01
PubTator Score 130.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.400 0.000
lung cancer 1.200 0.003

Synonym

Accession Q16531 A6NG77 B2R648 B4DG00 O15176 Q13289 Q58F96
Symbols XPE
DDBA
XAP1
XPCE
XPE-BF
UV-DDB1

Gene

PDB

2HYE   4A0K   4A0L   5HXB   3I8C   3I8E   4TZ4   5FQD   3I7O   3EI4   3I7L   4E54   4E5Z   3I7P   2B5L   2B5M   2B5N   3E0C   3EI1   3EI2   3EI3   3I7H   3I7K   3I7N   3I89   4A08   4A09   4A0A   4A0B   4A11   4CI1   4CI2   4CI3  

Gene RIF (141)

PMID Text
26401039 DDB1-specific shRNA silencing demonstrates that DDB1 enhances TNF-alpha secretion from wild type HIV-1(NL43) infected AND delta-vpr HIV-infected MT4C5 cells suggesting that DDB1 enhances TNF-alpha release from HIV-1-infected cells independently of Vpr
26255936 These results revealed a novel role of DDB in H3K56Ac deacetylation during early step of NER and the existence of active functional cross-talk between DDB-mediated damage recognition and H3K56Ac deacetylation.
26021757 Our data are consistent with the idea that the CUL4A/B-DDB1-CRBN complex catalyses the polyubiquitination and thus controls the degradation of CLC-1 channels.
25807049 DDB1-specific shRNA silencing demonstrates that DDB1 enhances TNF-alpha secretion from wild type HIV-1(NL43) infected AND delta-vpr HIV-infected MT4C5 cells suggesting that DDB1 enhances TNF-alpha release from HIV-1-infected cells independently of Vpr
25807049 DDB1-specific shRNA silencing demonstrates that DDB1 enhances TNF-alpha secretion from wild type HIV-1(NL43) infected AND delta-vpr HIV-infected MT4C5 cells suggesting that DDB1 enhances TNF-alpha release from HIV-1-infected cells independently of Vpr
25108355 The study presents the crystal structure of human CRBN bound to DDB1 and the drug lenalidomide.
25043012 structures of the DDB1-CRBN complex bound to thalidomide, lenalidomide and pomalidomide
24989250 CUL4A-DDB1-Rbx1 E3 ligase controls the quality of the PTS2 receptor Pex7p.
24912982 The identification of Vpr mutants which associate with DCAF1 but only poorly with DDB1 suggests that DCAF1 is necessary but is not sufficient for the Vpr association with DDB1-containing E3 ligase complex.
24760829 UV-DDB examines sites on DNA in discrete steps before forming long-lived, nonmotile UV-DDB dimers (DDB1-DDB2)2 at sites of damage.
More...

AA Sequence

MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPK      1 - 70
GESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLF     71 - 140
KVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQE    141 - 210
NVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRL    211 - 280
FMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAM    281 - 350
ETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRE    351 - 420
TDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEW    421 - 490
KEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGL    491 - 560
WTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVT    561 - 630
LGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLT    631 - 700
IGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKL    701 - 770
FSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEE    771 - 840
AEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIM    841 - 910
ALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKD    911 - 980
SAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNL    981 - 1050
LLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGM   1051 - 1120
KREATADDLIKVVEELTRIH                                                     1121 - 1140
//

Text Mined References (123)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26255936 2015 Damaged DNA-binding protein down-regulates epigenetic mark H3K56Ac through histone deacetylase 1 and 2.
26021757 2015 The Cullin 4A/B-DDB1-Cereblon E3 Ubiquitin Ligase Complex Mediates the Degradation of CLC-1 Chloride Channels.
25108355 2014 Structure of the human Cereblon-DDB1-lenalidomide complex reveals basis for responsiveness to thalidomide analogs.
25043012 2014 Structure of the DDB1-CRBN E3 ubiquitin ligase in complex with thalidomide.
24989250 2014 CUL4A-DDB1-Rbx1 E3 ligase controls the quality of the PTS2 receptor Pex7p.
24912982 2014 Interactions with DCAF1 and DDB1 in the CRL4 E3 ubiquitin ligase are required for Vpr-mediated G2 arrest.
24760829 2014 Single-molecule analysis reveals human UV-damaged DNA-binding protein (UV-DDB) dimerizes on DNA via multiple kinetic intermediates.
24412650 2014 Premature activation of the SLX4 complex by Vpr promotes G2/M arrest and escape from innate immune sensing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...