Property Summary

NCBI Gene PubMed Count 12
PubMed Score 10.33
PubTator Score 5.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (32)

Disease log2 FC p
active Crohn's disease 1.151 3.0e-02
adrenocortical carcinoma 1.911 7.3e-04
adult high grade glioma 2.200 1.1e-05
astrocytoma 2.300 2.1e-19
Astrocytoma, Pilocytic 1.700 2.8e-06
Breast cancer -1.200 1.1e-02
breast carcinoma -1.200 1.9e-03
chronic rhinosinusitis -2.097 5.4e-03
colon cancer -2.800 1.4e-02
cutaneous lupus erythematosus 1.400 1.8e-02
dermatomyositis 2.100 2.5e-03
ependymoma 2.700 1.9e-02
esophageal adenocarcinoma -1.800 2.8e-02
fibroadenoma -1.300 1.0e-02
glioblastoma 2.400 2.9e-10
group 3 medulloblastoma 1.800 9.9e-04
intraductal papillary-mucinous adenoma (... -3.300 5.1e-06
intraductal papillary-mucinous carcinoma... -2.900 5.1e-04
intraductal papillary-mucinous neoplasm ... -2.200 1.9e-03
invasive ductal carcinoma -1.600 1.3e-02
lung adenocarcinoma -1.033 7.9e-03
lung cancer 1.500 8.1e-05
malignant mesothelioma -2.700 1.3e-08
medulloblastoma, large-cell 2.300 2.6e-04
non primary Sjogren syndrome sicca 1.100 1.9e-02
oligodendroglioma 1.900 8.0e-10
osteosarcoma 1.890 3.2e-02
pancreatic ductal adenocarcinoma liver m... -1.285 7.5e-04
pituitary cancer 2.300 6.7e-05
primitive neuroectodermal tumor 1.500 2.3e-04
ulcerative colitis 2.700 5.9e-06
X-linked cerebral adrenoleukodystrophy 2.200 4.7e-02

Gene RIF (1)

AA Sequence

MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKG      1 - 70
YGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWH     71 - 140
KNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ                     141 - 193
//

Text Mined References (14)

PMID Year Title