Property Summary

NCBI Gene PubMed Count 29
PubMed Score 107.39
PubTator Score 201.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -4.000 2.4e-07
astrocytic glioma -1.400 4.5e-03
Astrocytoma, Pilocytic -4.800 3.6e-18
atypical teratoid / rhabdoid tumor -2.800 4.0e-05
cutaneous lupus erythematosus 1.200 2.8e-02
cystic fibrosis 1.500 2.5e-04
ependymoma -5.100 1.0e-23
glioblastoma -3.500 1.3e-08
interstitial cystitis -1.400 2.8e-03
lung carcinoma 6.100 2.4e-72
malignant mesothelioma 1.500 6.0e-06
oligodendroglioma -1.200 3.1e-04
osteosarcoma 1.400 4.6e-03
Pick disease -1.800 2.4e-02
psoriasis 1.600 6.2e-10

Gene RIF (15)

AA Sequence

MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPP      1 - 70
ASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVG     71 - 140
ELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLAR    141 - 210
LDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNL    211 - 280
QSAEEWYKSKFANLNEQAARSTEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAE    281 - 350
VAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPL    351 - 420
PNPSYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIE    421 - 490
ETTISSQKI                                                                 491 - 499
//

Text Mined References (33)

PMID Year Title