Property Summary

NCBI Gene PubMed Count 29
Grant Count 5
R01 Count 5
Funding $609,411
PubMed Score 105.20
PubTator Score 201.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
astrocytoma -2.600 0.034
psoriasis 3.000 0.000
cutaneous lupus erythematosus 1.200 0.028
glioblastoma -3.500 0.000
oligodendroglioma -1.200 0.000
osteosarcoma 1.400 0.005
ependymoma -5.100 0.000
atypical teratoid/rhabdoid tumor -2.900 0.000
interstitial cystitis -1.500 0.000
cystic fibrosis 1.500 0.000
adult high grade glioma -4.000 0.000
pilocytic astrocytoma -4.800 0.000
lung carcinoma 6.100 0.000
Pick disease -1.800 0.024

Synonym

Accession Q16352 B1AQK0 Q9BRC5 Alpha-Inx
Symbols NEF5
NF-66
TXBP-1

Gene

INA

Gene RIF (18)

PMID Text
26233522 It is a neuronal marker, and has been indicated as an immunohistochemical surrogate of chromosome 1p/19q co-deletion in oligodendroglial tumors.
25236435 Gonadotropinomas, null cell pituitary adenomas, and thyrotropinomas exhibit high levels of intracellular INA protein indicating neuronal transdifferentiation.
24483152 alpha-Internexin was expressed in 53% of 350 pancreatic neuroendocrine tumors. Reduced expression of alpha-internexin was significantly associated with advanced stage metastases, recurrence and shorter overall survival.
24197863 It is a supportive diagnostic marker for oligodendroglial tumors with the 1p/19q co-deletion.
23125841 Tandem affinity purification and mass spectrometry analysis identify internexin neuronal intermediate filament protein alpha unit (INA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify internexin neuronal intermediate filament protein alpha unit (INA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify internexin neuronal intermediate filament protein alpha unit (INA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify internexin neuronal intermediate filament protein alpha unit (INA), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22890969 High INA expression is associated with grade II gliomas.
21990041 INA may provide additional biologic information relevant to delineation of both pancreatic neuroendocrine neoplasms (NEN) tumor phenotypes and clinical behavior.
More...

AA Sequence

MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPP      1 - 70
ASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVG     71 - 140
ELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLAR    141 - 210
LDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNL    211 - 280
QSAEEWYKSKFANLNEQAARSTEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAE    281 - 350
VAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPL    351 - 420
PNPSYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIE    421 - 490
ETTISSQKI                                                                 491 - 499
//

Text Mined References (33)

PMID Year Title
26233522 2015 Coexpression of cyclin D1 and alpha-internexin in oligodendroglial tumors.
25236435 2015 Expression pattern of neuronal intermediate filament ?-internexin in anterior pituitary gland and related tumors.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24483152 2014 ?-Internexin: a novel biomarker for pancreatic neuroendocrine tumor aggressiveness.
24197863 2014 Alpha-internexin and altered CIC expression as a supportive diagnostic marker for oligodendroglial tumors with the 1p/19q co-deletion.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22890969 2012 Molecular genetics of adult grade II gliomas: towards a comprehensive tumor classification system.
22683712 2012 Genome-wide association analysis identifies susceptibility loci for migraine without aura.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
More...