Property Summary

NCBI Gene PubMed Count 105
Grant Count 243
R01 Count 124
Funding $41,936,546.43
PubMed Score 576.71
PubTator Score 526.32

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16270 B4E1N2 B7Z9W7 Q07822 Q53YE6 Q9UCA8 IBP-7
Symbols AGM
PSF
TAF
FSTL2
IBP-7
MAC25
IGFBP-7
RAMSVPS
IGFBP-7v
IGFBPRP1

Gene

Gene RIF (79)

PMID Text
26974954 data suggest that TGF-beta1 enhances IGFBP7 via Smad2/4 pathways, and that IGFBP7 might be involved in the TGF-beta1-induced tubular injury in DN.
26706909 Insulin-like growth factor binding protein 7 (IGFBP7) was proven to be associated with metastatic clinicopathological features and high lymphatic vascular density
26606754 This study shows that urinary [TIMP-2]*[IGFBP7] has a good diagnostic performance in predicting adverse outcomes in neonatal and pediatric AKI of heterogeneous etiology.
26474694 This process not only provides a remarkable high expression at ~50mg/L and pure glycosylated mammalian rhIGFBP7, also highlights that transient gene expression technology is practical to be used for production
26450156 Inhibition of IGF1-R overcomes IGFBP7-induced chemotherapy resistance in T-ALL
26387651 low expression in breast cancer tissue
26043748 Overexpression of IGFBP7 was associated with tumour progression and poor survival in gastric cancer. IGFBP7 may play a role in tumour progression in gastric cancer.
25984973 serum IGFBP7 levels are associated with IR and MetS, providing new insight into the mechanism of IR and Mets. IGFBP7 may be a potential interventional target for IR and Mets.
25887188 Our data indicate that IGFBP7 expression is a marker for a specific methylation pattern in myeloma
25886299 The low levels of IGFBP7 in high-grade serous ovarian carcinoma are associated with survival rate.
More...

AA Sequence

MERPSLRALLLGAAGLLLLLLPLSSSSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEP      1 - 70
CGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRA     71 - 140
ESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLP    141 - 210
GDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGA    211 - 280
EL                                                                        281 - 282
//

Text Mined References (109)

PMID Year Title
26974954 2016 Role of IGFBP7 in Diabetic Nephropathy: TGF-?1 Induces IGFBP7 via Smad2/4 in Human Renal Proximal Tubular Epithelial Cells.
26706909 2016 IGFBP7 functions as a potential lymphangiogenesis inducer in non-small cell lung carcinoma.
26606754 2015 Urinary Tissue Inhibitor of Metalloproteinase-2 (TIMP-2) • Insulin-Like Growth Factor-Binding Protein 7 (IGFBP7) Predicts Adverse Outcome in Pediatric Acute Kidney Injury.
26474694 2015 Mammalian cell transient expression, non-affinity purification, and characterization of human recombinant IGFBP7, an IGF-1 targeting therapeutic protein.
26450156 2015 Inhibition of IGF1-R overcomes IGFBP7-induced chemotherapy resistance in T-ALL.
26387651 2015 Histone 3 Trimethylation of IGFBP-7 Gene Promoter by Expression of D5 Stat5a in Breast Epithelial Cells.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26043748 2015 Relationship between expression of IGFBP7 and clinicopathological variables in gastric cancer.
25984973 2015 Serum IGFBP7 levels associate with insulin resistance and the risk of metabolic syndrome in a Chinese population.
25887188 2015 Insulin like growth factor binding protein 7 (IGFBP7) expression is linked to poor prognosis but may protect from bone disease in multiple myeloma.
More...