Property Summary

NCBI Gene PubMed Count 119
PubMed Score 379.97
PubTator Score 526.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cancer 2499 4.038 2.0
Kidney disease 430 3.034 1.5

Expression

  Differential Expression (33)

Disease log2 FC p
active Crohn's disease 1.885 2.5e-02
adult high grade glioma 1.300 4.4e-03
astrocytic glioma 1.600 5.8e-03
Astrocytoma, Pilocytic 1.500 1.5e-06
autosomal dominant Emery-Dreifuss muscul... 1.229 2.0e-02
Becker muscular dystrophy 1.118 3.1e-02
Breast cancer 2.100 1.2e-11
Common variable immunodeficiency -1.672 7.8e-05
cystic fibrosis -2.150 3.4e-07
dermatomyositis 1.700 1.1e-02
Down syndrome 1.200 2.9e-03
Duchenne muscular dystrophy 1.319 2.2e-08
ependymoma 1.800 6.5e-03
esophageal adenocarcinoma 1.600 4.3e-02
gastric carcinoma 1.900 1.2e-02
glioblastoma 1.100 8.2e-05
intraductal papillary-mucinous adenoma (... -2.800 6.5e-04
intraductal papillary-mucinous carcinoma... -3.200 2.2e-03
intraductal papillary-mucinous neoplasm ... -2.800 3.9e-03
juvenile dermatomyositis 1.485 7.4e-13
limb girdle muscular dystrophy 2A 1.118 1.6e-05
malignant mesothelioma -3.000 1.0e-08
oligodendroglioma 1.600 6.1e-03
ovarian cancer -2.800 2.6e-07
pancreatic cancer 1.900 1.9e-04
primary pancreatic ductal adenocarcinoma 1.735 4.8e-04
primary Sjogren syndrome 2.000 1.1e-02
psoriasis 1.400 8.1e-04
tuberculosis 1.400 1.2e-06
ulcerative colitis 2.000 1.8e-05
urothelial carcinoma 2.300 1.5e-07
Waldenstrons macroglobulinemia 2.426 3.1e-02
X-linked agammaglobulinemia -1.520 4.7e-02

Gene RIF (91)

AA Sequence

MERPSLRALLLGAAGLLLLLLPLSSSSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEP      1 - 70
CGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRA     71 - 140
ESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLP    141 - 210
GDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGA    211 - 280
EL                                                                        281 - 282
//

Text Mined References (123)

PMID Year Title