Property Summary

NCBI Gene PubMed Count 13
PubMed Score 204.90
PubTator Score 32.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma -1.136 6.8e-04
astrocytic glioma -1.100 4.2e-02
group 3 medulloblastoma 1.100 1.2e-02
intraductal papillary-mucinous adenoma (... 1.200 6.7e-03
invasive ductal carcinoma -1.041 3.3e-02
Multiple myeloma 1.513 4.0e-03
ovarian cancer -1.900 1.2e-08
pancreatic ductal adenocarcinoma liver m... -2.093 1.2e-02
psoriasis -1.100 1.1e-02
spina bifida -2.180 3.2e-02
tuberculosis -1.100 6.6e-06

Gene RIF (3)

AA Sequence

MNINDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSHQKNVDARME      1 - 70
PVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQA     71 - 140
ERILKLQQVAEKYYGNKCIIPWYIMTSGRTMESTKEFFTKHKYFGLKKENVIFFQQGMLPAMSFDGKIIL    141 - 210
EEKNKVSMAPDGNGGLYRALAAQNIVEDMEQRGIWSIHVYCVDNILVKVADPRFIGFCIQKGADCGAKVV    211 - 280
EKTNPTEPVGVVCRVDGVYQVVEYSEISLATAQKRSSDGRLLFNAGNIANHFFTVPFLRDVVNVYEPQLQ    281 - 350
HHVAQKKIPYVDTQGQLIKPDKPNGIKMEKFVFDIFQFAKKFVVYEVLREDEFSPLKNADSQNGKDNPTT    351 - 420
ARHALMSLHHCWVLNAGGHFIDENGSRLPAIPRSATNGKSETITADVNHNLKDANDVPIQCEISPLISYA    421 - 490
GEGLESYVADKEFHAPLIIDENGVHELVKNGI                                          491 - 522
//

Text Mined References (16)

PMID Year Title