Property Summary

NCBI Gene PubMed Count 13
PubMed Score 184.29
PubTator Score 32.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.62897047446516E-8
ovarian cancer 8492 8.16570089633594E-7
tuberculosis and treatment for 3 months 327 2.55038267572654E-4
adrenocortical carcinoma 1427 6.80608804355232E-4
Multiple myeloma 1328 0.00402569195966741
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00670499108081063
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0115232513899262
group 3 medulloblastoma 2254 0.0119460825179907
spina bifida 1064 0.0317709221918531
invasive ductal carcinoma 2950 0.0329183796854317
astrocytic glioma 2241 0.0418961377399928

Expression

  Differential Expression (11)

Synonym

Accession Q16222 B2R6R8 Q5VTA9 Q5VTB0 Q5VTB1 Q96GM2
Symbols AGX
AGX1
AGX2
SPAG2

Gene

PANTHER Protein Class (2)

PDB

1JV1   1JV3   1JVD   1JVG  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (3)

PMID Text
25241896 Results identified an enzyme, UAP1, which is highly overexpressed in prostate cancer and protects cancer cells from endoplasmic reticulum stress conferring a growth advantage.
19536175 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of UDP-N-acteylglucosamine pyrophosphorylase 1 (UAP1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MNINDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSHQKNVDARME      1 - 70
PVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQA     71 - 140
ERILKLQQVAEKYYGNKCIIPWYIMTSGRTMESTKEFFTKHKYFGLKKENVIFFQQGMLPAMSFDGKIIL    141 - 210
EEKNKVSMAPDGNGGLYRALAAQNIVEDMEQRGIWSIHVYCVDNILVKVADPRFIGFCIQKGADCGAKVV    211 - 280
EKTNPTEPVGVVCRVDGVYQVVEYSEISLATAQKRSSDGRLLFNAGNIANHFFTVPFLRDVVNVYEPQLQ    281 - 350
HHVAQKKIPYVDTQGQLIKPDKPNGIKMEKFVFDIFQFAKKFVVYEVLREDEFSPLKNADSQNGKDNPTT    351 - 420
ARHALMSLHHCWVLNAGGHFIDENGSRLPAIPRSATNGKSETITADVNHNLKDANDVPIQCEISPLISYA    421 - 490
GEGLESYVADKEFHAPLIIDENGVHELVKNGI                                          491 - 522
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25241896 2015 UAP1 is overexpressed in prostate cancer and is protective against inhibitors of N-linked glycosylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...