Property Summary

NCBI Gene PubMed Count 47
Grant Count 10
R01 Count 7
Funding $798,968.17
PubMed Score 117.49
PubTator Score 54.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.906 0.001
Multiple myeloma 1.710 0.000
astrocytic glioma -1.700 0.003
ependymoma -2.200 0.006
oligodendroglioma -1.700 0.009
cutaneous lupus erythematosus -1.300 0.000
psoriasis -1.500 0.001
glioblastoma -2.400 0.000
osteosarcoma -1.362 0.008
medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.200 0.003
primary pancreatic ductal adenocarcinoma 1.417 0.001
pediatric high grade glioma -1.700 0.000
subependymal giant cell astrocytoma -1.520 0.016
Alzheimer's disease -1.100 0.035
Pick disease -1.400 0.000
progressive supranuclear palsy -1.100 0.042
ovarian cancer -1.800 0.000

Gene RIF (26)

PMID Text
25380047 Septin6 and Septin7 GTP binding proteins regulate AP-3- and ESCRT-dependent multivesicular body biogenesis
24685401 Significantly lower SEPT7 expression in all expressional categories in encapsulated papillary thyroid carcinoma, follicular variant group may be a sign of different molecular signature in this type of tissue.
24685401 Significantly lower SEPT7 expression in encapsulated follicular variant of papillary thyroid carcinoma may be a sign of different molecular signature in this type of tissue.
24345743 In response to Candida albicans infection, SEPT7 forms a complex with endothelial cell N-cadherin, is required for normal accumulation of N-cadherin around hyphae, and is necessary for maximal fungal endocytosis.
24055994 Overexpression of the yeast septin7 ortholog CDC10 also conferred resistance to the negative effects of copper as well as protecting cells from the overexpression of Bax.
23572511 SEPT2 forms a 1:1:1 complex with SEPT7 and SEPT9.
23383034 miR-30a-5p is a bona fide negative regulator of SEPT7 and the oncogenic activity of miR-30a-5p in human gliomas is at least in part through the repression of SEPT7
22956766 Myeloid K562 cells express three SEPT9 isoforms, all of which have an equal propensity to hetero-oligomerize with SEPT7-containing hexamers to generate octameric heteromers.
22064074 the purification, crystallization and structure for the GTP-binding domain of human septin 7
21824007 Sept7 occupies the ends of hexameric building blocks which assemble into non-polarised filaments.
More...

AA Sequence

MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSL      1 - 70
FLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFED     71 - 140
YLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQ    141 - 210
IMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHC    211 - 280
DFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKM    281 - 350
KKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQ    351 - 420
QNSSRTLEKNKKKGKIF                                                         421 - 437
//

Text Mined References (57)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25588830 2015 SEPT12 orchestrates the formation of mammalian sperm annulus by organizing core octameric complexes with other SEPT proteins.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25380047 2014 Septin6 and Septin7 GTP binding proteins regulate AP-3- and ESCRT-dependent multivesicular body biogenesis.
24685401 2014 Septin 7 immunoexpression in papillary thyroid carcinoma: a preliminary study.
24345743 2013 Role of endothelial cell septin 7 in the endocytosis of Candida albicans.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24055994 2013 The human septin7 and the yeast CDC10 septin prevent Bax and copper mediated cell death in yeast.
23572511 2013 Septins 2, 7 and 9 and MAP4 colocalize along the axoneme in the primary cilium and control ciliary length.
More...