Property Summary

NCBI Gene PubMed Count 51
PubMed Score 124.97
PubTator Score 54.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.200 2.8e-03
Alzheimer's disease -1.100 3.5e-02
astrocytic glioma -1.700 3.2e-03
atypical teratoid / rhabdoid tumor -2.400 2.0e-08
cutaneous lupus erythematosus -1.300 4.9e-04
ependymoma -2.200 5.9e-03
glioblastoma -1.200 5.1e-04
group 4 medulloblastoma -1.400 1.5e-03
medulloblastoma, large-cell -1.600 1.9e-06
Multiple myeloma 1.710 4.2e-04
oligodendroglioma -1.700 8.7e-03
osteosarcoma 1.322 2.3e-04
ovarian cancer -1.800 7.3e-09
Pick disease -1.400 1.3e-04
primary pancreatic ductal adenocarcinoma 1.417 1.1e-03
primitive neuroectodermal tumor -1.200 3.0e-03
progressive supranuclear palsy -1.100 4.2e-02
psoriasis 1.300 4.2e-04
subependymal giant cell astrocytoma -1.520 1.6e-02
Waldenstrons macroglobulinemia 1.906 1.4e-03

Gene RIF (30)

AA Sequence

MSVSARSAAAEERSVNSSTMVAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSL      1 - 70
FLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFED     71 - 140
YLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQ    141 - 210
IMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHC    211 - 280
DFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKM    281 - 350
KKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQ    351 - 420
QNSSRTLEKNKKKGKIF                                                         421 - 437
//

Text Mined References (61)

PMID Year Title