Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Synonym

Accession Q16048 Q9BQ10
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MLSQKPKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTQEKRETGDEENSAKFPVGRRDFD      1 - 70
TLSCMLGRVYQSCWQV                                                           71 - 86
//

Text Mined References (6)

PMID Year Title
19068116 2008 Primate-specific spliced PMCHL RNAs are non-protein coding in human and macaque tissues.
11181993 2001 Birth of two chimeric genes in the Hominidae lineage.
11070051 2000 Structure and expression of the variant melanin-concentrating hormone genes: only PMCHL1 is transcribed in the developing human brain and encodes a putative protein.
9729295 1998 Antisense expression of the human pro-melanin-concentrating hormone genes.
8326825 1993 Isolation and characterization of the human melanin-concentrating hormone gene and a variant gene.
8188237 1994 Assignment of the human pro-melanin-concentrating hormone gene (PMCH) to chromosome 12q23-q24 and two variant genes (PMCH1 and PMCHL2) to chromosome 5p14 and 5q12-q13.