Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Synonym

Accession Q16048 Q9BQ10
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MLSQKPKKKHNFLNHGLSLNLVIKPYLALEGSVAFPAENGVQDTESTQEKRETGDEENSAKFPVGRRDFD      1 - 70
TLSCMLGRVYQSCWQV                                                           71 - 86
//

Text Mined References (6)

PMID Year Title