Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.50
PubTator Score 7.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active ulcerative colitis -1.242 4.9e-02
atypical teratoid / rhabdoid tumor 1.300 2.0e-04
glioblastoma 1.100 1.5e-03
group 3 medulloblastoma 1.800 4.8e-05
lung cancer 1.300 3.0e-03
medulloblastoma, large-cell 3.000 1.3e-06
non primary Sjogren syndrome sicca -1.600 1.5e-02
osteosarcoma -1.167 1.1e-02
Pick disease 1.800 3.4e-04
primitive neuroectodermal tumor 1.700 1.6e-03
psoriasis -1.100 5.5e-03
subependymal giant cell astrocytoma 1.542 4.3e-02

Gene RIF (1)

AA Sequence

MSGHPGSWEMNSVAFEDVAVNFTQEEWALLDPSQKNLYRDVMQETFRNLASIGNKGEDQSIEDQYKNSSR      1 - 70
NLRHIISHSGNNPYGCEECGKKPCTCKQCQKTSLSVTRVHRDTVMHTGNGHYGCTICEKVFNIPSSFQIH     71 - 140
QRNHTGEKPYECMECGKALGFSRSLNRHKRIHTGEKRYECKQCGKAFSRSSHLRDHERTHTGEKPYECKH    141 - 210
CGKAFRYSNCLHYHERTHTGEKPYVCMECGKAFSCLSSLQGHIKAHAGEEPYPCKQCGKAFRYASSLQKH    211 - 280
EKTHIAQKPYVCNNCGKGFRCSSSLRDHERTHTGEKPYECQKCGKAFSRASTLWKHKKTHTGEKPYKCKK    281 - 350
M//

Text Mined References (11)

PMID Year Title