Property Summary

NCBI Gene PubMed Count 65
Grant Count 57
R01 Count 43
Funding $8,007,547.02
PubMed Score 159.25
PubTator Score 85.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
ependymoma 1.200 0.004
glioblastoma 2.900 0.000
osteosarcoma -1.135 0.017
cystic fibrosis -1.194 0.000
astrocytoma 1.400 0.001
non diabetic and post-ischemic heart fai... -1.200 0.002
atypical teratoid / rhabdoid tumor 2.200 0.000
medulloblastoma 1.200 0.005
primitive neuroectodermal tumor 1.100 0.023
primary pancreatic ductal adenocarcinoma 1.352 0.013
lung cancer -1.300 0.006
pediatric high grade glioma 2.200 0.000
pilocytic astrocytoma 1.400 0.001
lung carcinoma -2.200 0.000
gastric carcinoma 1.900 0.028
ovarian cancer 1.700 0.000
pancreatic cancer 1.100 0.022

Synonym

Accession Q15942 A4D2G6 B4DQX7 Q6I9S4
Symbols ESP-2
HED-2

Gene

ZYX

Gene RIF (31)

PMID Text
27125030 Zyxin binding to Ptc2 is due to the interaction of Zyxin 2nd LIM-domain (530-590 aa) with the under-membrane region of the cytoplasmic C-terminus of Ptc2 (1159-1412 aa).
26611125 VASP, zyxin and TES are tension-dependent members of focal adherens junctions independent of the alpha-catenin-vinculin module.
26071033 key regulator of stretch-induced gene expression at the cellular level
25771989 ZYX gene may be aging-related gene and involved in Osteoporosis.
25038525 Matrix density alters zyxin phosphorylation, which limits peripheral process formation and extension in endothelial cells invading 3D collagen matrices.
25025691 Zyxin, which is thought to be essential for tight cell-to-cell junctions, decreased 1.8-fold in TNF-alpha-treated human brain microvascular endothelial cells.
24036928 Integrin-beta5 and zyxin mediate formation of ventral stress fibers in response to transforming growth factor beta.
23330981 Zyxin is a novel target for beta-amyloid peptide activities in Alzheimer's disease.
23321499 RA-induced cancer cell cytotoxicity was significantly impaired by Zyxin or PTOV1. Overall, our findings suggest that Zyxin and PTOV1 should be considered as critical determinants in cancer therapy with retinoids
23292068 Zyxin is suggested to promote growth, migration and invasiveness of fibroblastic type oral squamous cell carcinoma cells by upregulating Rac1 and Cdc42.
More...

AA Sequence

MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPED      1 - 70
FPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREK     71 - 140
VSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLP    141 - 210
QVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKF    211 - 280
SPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGP    281 - 350
LTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQ    351 - 420
GQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRP    421 - 490
HCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHV    491 - 560
LCRKCHTARAQT                                                              561 - 572
//

Text Mined References (82)

PMID Year Title
27125030 [The Cytoskelrtal Protein Zvxin Interacts with the Hedgehog Receptor Patched].
26611125 2015 VASP, zyxin and TES are tension-dependent members of Focal Adherens Junctions independent of the ?-catenin-vinculin module.
26071033 2015 Loss of the mechanotransducer zyxin promotes a synthetic phenotype of vascular smooth muscle cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25771989 2015 Comprehensive transcriptome analysis of mesenchymal stem cells in elderly patients with osteoporosis.
25416956 2014 A proteome-scale map of the human interactome network.
25038525 2014 Matrix density alters zyxin phosphorylation, which limits peripheral process formation and extension in endothelial cells invading 3D collagen matrices.
25025691 2014 Zyxin modulates the transmigration of Haemophilus influenzae to the central nervous system.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
More...