Property Summary

NCBI Gene PubMed Count 67
PubMed Score 168.45
PubTator Score 85.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.800 1.0e-03
astrocytoma 1.400 1.2e-03
Astrocytoma, Pilocytic 1.300 8.6e-04
atypical teratoid / rhabdoid tumor 2.200 1.5e-06
cystic fibrosis -1.194 2.6e-04
ependymoma 1.200 4.2e-03
gastric carcinoma 1.900 2.8e-02
glioblastoma 1.400 5.4e-04
lung cancer -1.300 5.6e-03
lung carcinoma -2.200 1.3e-42
medulloblastoma 1.200 5.0e-03
non diabetic and post-ischemic heart fai... -1.200 2.1e-03
osteosarcoma -1.135 1.7e-02
ovarian cancer -1.100 2.0e-05
pancreatic cancer 1.100 2.2e-02
primary pancreatic ductal adenocarcinoma 1.352 1.3e-02
primitive neuroectodermal tumor 1.100 2.3e-02

Protein-protein Interaction (10)

Gene RIF (32)

AA Sequence

MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPED      1 - 70
FPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREK     71 - 140
VSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLP    141 - 210
QVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKF    211 - 280
SPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGP    281 - 350
LTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQ    351 - 420
GQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRP    421 - 490
HCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHV    491 - 560
LCRKCHTARAQT                                                              561 - 572
//

Text Mined References (85)

PMID Year Title