Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
Funding $232,073.38
PubMed Score 134.13
PubTator Score 28.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma 1.273 0.007
group 3 medulloblastoma 1.300 0.000
tuberculosis and treatment for 6 months -1.200 0.000
lung cancer 1.400 0.000
lung adenocarcinoma 1.200 0.000
acute myeloid leukemia -1.800 0.029
ovarian cancer 1.400 0.000

Synonym

Accession Q15906 A6NLK9 A6PW55 Q53GJ2 Q5U0R4
Symbols YL1
CFL1
Swc2
YL-1
TCFL1

Gene

 Grant Application (1)

PDB

5FUG  

Gene RIF (2)

PMID Text
26974126 The 2.7-A-resolution crystal structure of the human YL1-H2A.Z-H2B complex shows that YL1 binding, similarly to ANP32E binding, triggers an extension of the H2A.Z alphaC helix.
15647280 Results identify YL1 as a subunit of the TRRAP/TIP60 HAT complex, and also as a component of a novel mammalian multiprotein complex that includes the SNF2-related helicase SRCAP.

AA Sequence

MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPS      1 - 70
SDGEAEEPRRKRRVVTKAYKEPLKSLRPRKVNTPAGSSQKAREEKALLPLELQDDGSDSRKSMRQSTAEH     71 - 140
TRQTFLRVQERQGQSRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADKKKQVHKKRKCPGP    141 - 210
IITYHSVTVPLVGEPGPKEENVDIEGLDPAPSVSALTPHAGTGPVNPPARCSRTFITFSDDATFEEWFPQ    211 - 280
GRPPKVPVREVCPVTHRPALYRDPVTDIPYATARAFKIIREAYKKYITAHGLPPTASALGPGPPPPEPLP    281 - 350
GSGPRALRQKIVIK                                                            351 - 364
//

Text Mined References (18)

PMID Year Title
26974126 2016 Molecular basis and specificity of H2A.Z-H2B recognition and deposition by the histone chaperone YL1.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22096247 2012 Integrin-?v?3 regulates thrombopoietin-mediated maintenance of hematopoietic stem cells.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...