Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.83
PubTator Score 4.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
osteosarcoma -1.071 0.000
glioblastoma -1.700 0.007
cystic fibrosis -2.409 0.000
periodontitis 1.200 0.000
atypical teratoid / rhabdoid tumor -1.700 0.001
medulloblastoma, large-cell -2.200 0.000
lung cancer 2.600 0.000
ulcerative colitis 1.800 0.003
sarcoidosis 1.100 0.036
interstitial cystitis 1.800 0.000
pediatric high grade glioma -1.200 0.007
primary Sjogren syndrome 1.300 0.001
psoriasis -1.500 0.000
lung carcinoma 1.500 0.000
spina bifida -1.974 0.026
Pick disease 1.100 0.000
mucosa-associated lymphoid tissue lympho... 1.602 0.029
ductal carcinoma in situ -1.500 0.000
ovarian cancer -2.700 0.000

Synonym

Accession Q15771 Q6FGK1 Q6MZH2 Q96CI8
Symbols

Gene

PDB

2EW1  

Gene RIF (2)

PMID Text
23615442 Data indicate taht the parasitophorous vacuole (PV), marked with Rab14, Rab30, or Rab43, colocalize with host-derived sphingolipids in the vacuolar space.
22188167 Rab30 is primarily expressed in the Golgi apparatus and is required for the structural integrity of this organelle.

AA Sequence

MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQER      1 - 70
FRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEF     71 - 140
SEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNFN           141 - 203
//

Text Mined References (17)

PMID Year Title
23615442 2013 Toxoplasma gondii salvages sphingolipids from the host Golgi through the rerouting of selected Rab vesicles to the parasitophorous vacuole.
23326517 2013 Insights into the genetic architecture of early stage age-related macular degeneration: a genome-wide association study meta-analysis.
22566634 2012 The genetic architecture of economic and political preferences.
22188167 2012 Rab30 is required for the morphological integrity of the Golgi apparatus.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...