Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.33
PubTator Score 4.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active ulcerative colitis -1.013 3.3e-02
atypical teratoid / rhabdoid tumor -1.700 5.9e-04
cystic fibrosis -1.153 6.3e-04
ductal carcinoma in situ -1.500 2.5e-04
glioblastoma -1.200 2.5e-04
interstitial cystitis 1.300 7.7e-03
lung cancer 2.600 3.6e-04
lung carcinoma 1.500 3.3e-13
medulloblastoma, large-cell -2.100 2.2e-05
mucosa-associated lymphoid tissue lympho... 1.602 2.9e-02
osteosarcoma -1.071 9.6e-05
ovarian cancer -2.300 4.6e-09
pediatric high grade glioma -1.200 6.8e-03
periodontitis 1.200 3.4e-27
Pick disease 1.100 6.4e-05
primary Sjogren syndrome 1.300 9.8e-04
psoriasis -1.300 2.1e-08
sarcoidosis 1.100 3.6e-02
spina bifida -1.974 2.6e-02

Gene RIF (2)

AA Sequence

MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQER      1 - 70
FRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEF     71 - 140
SEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNFN           141 - 203
//

Text Mined References (17)

PMID Year Title