Property Summary

NCBI Gene PubMed Count 12
PubMed Score 21.59
PubTator Score 5.83

Knowledge Summary

Patent

No data available

Synonym

Accession Q15695 B2R901 Q13570 Q2M3R8
Symbols U2AF1P
ZC3H21
U2AF1L1
U2AFBPL
U2AF1RS1
U2AF1-RS1

Gene

AA Sequence

MAALEKMTFPKKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQEEEEDTFIEEQQLEEEKLLE      1 - 70
RERERLHEEWLLREQKAQEEFRIKKEKEEAAKKWLEEQERKLKEQWKEQQRKEREEEEQKQQEKKEKEEA     71 - 140
VQKMLDQAENDLENSTTWQNPEPPVDFRVMEKDRANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSM    141 - 210
FTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQ    211 - 280
SEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRD    281 - 350
IYLSSDQTGSSFGKNSERREKMGHHDHYYSRQRGRRNPSPDHTYKRNGESERKKSSHRGKKSHKRTSKSR    351 - 420
ERHNSPSRGRNRHRSWDQGRRSQSRRSHRSRSQSSSRCRSRGRRKSGNRDRTVQSPQSK               421 - 479
//

Text Mined References (13)

PMID Year Title
21166792 2011 A case-by-case evolutionary analysis of four imprinted retrogenes.
16305817 2006 Comparative analyses of genomic imprinting and CpG island-methylation in mouse Murr1 and human MURR1 loci revealed a putative imprinting control region in mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12558503 2003 U2 small nuclear ribonucleoprotein particle (snRNP) auxiliary factor of 65 kDa, U2AF65, can promote U1 snRNP recruitment to 5' splice sites.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11118443 2001 Nucleocytoplasmic shuttling of heterodimeric splicing factor U2AF.
9490301 1998 Cloning and tissue expression of cDNAs from chromosome 5q21-22 which is frequently deleted in advanced lung cancer.
9237760 1997 A protein related to splicing factor U2AF35 that interacts with U2AF65 and SR proteins in splicing of pre-mRNA.
9001233 1997 Mouse U2af1-rs1 is a neomorphic imprinted gene.
More...