Property Summary

NCBI Gene PubMed Count 93
Grant Count 8
R01 Count 8
Funding $509,197
PubMed Score 35.58
PubTator Score 231.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.092 0.011
Multiple myeloma 1.501 0.001
astrocytoma 1.300 0.003
glioblastoma 1.300 0.002
oligodendroglioma 1.100 0.000
osteosarcoma 1.053 0.002
ependymoma 1.400 0.000
medulloblastoma 1.200 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.500 0.000
primitive neuroectodermal tumor 1.200 0.000
juvenile dermatomyositis 1.050 0.000
breast carcinoma 1.500 0.002
pediatric high grade glioma 1.100 0.000
ovarian cancer 2.000 0.000
dermatomyositis 1.200 0.003

Gene RIF (49)

PMID Text
26854759 The authors show that the microtubule binding protein EB1 (end-binding protein 1), a key regulator of microtubule dynamics, can bind directly to filamentous actin (F-actin) F-actin.
26498358 We propose a novel mechanism by which ATIP3-EB1 interaction indirectly reduces the kinetics of EB1 exchange on its recognition site, thereby accounting for negative regulation of microtubule dynamic instability
26342024 MAPRE1 can contribute to the detection of early-stage colorectal cancer and adenomas together with other biomarkers
25355949 A previously uncharacterized EB1 linker region tracks microtubule plus ends in live cells.
25297623 TTBK2 bound EB1 and Cep164 through its SxIP motifs and a proline-rich motif, respectively.
25225338 a subset of arrhythmogenic cardiomyopathy mutations, in addition to a mutation associated with skin fragility/woolly hair syndrome, impair gap junction localization and function by misregulating DP-EB1 interactions and altering microtubule dynamics.
25164813 EB1 has a role in linking AIM2 inflammasomes with autophagy-dependent secretion
25160006 We find that the presence of EB1 can stiffen microtubules in a manner that depends on the hydrolysis state of the tubulin-bound nucleotide
25048701 The functions of EB1 in the regulation of microtubule dynamics and recruitment of other +TIPs, as well as the dimerization of EB1, undergo exquisite control by phosphorylation.
25022754 Studies show that IQGAP1 functions as a hub linking HGF-induced signaling to microtubules and actin remodeling via EB1-IQGAP1-cortactin interactions.
More...

AA Sequence

MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHE      1 - 70
YIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPS     71 - 140
LVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDL    141 - 210
EKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY                211 - 268
//

Text Mined References (107)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26854759 2016 Interactions between the Microtubule Binding Protein EB1 and F-Actin.
26498358 2015 Negative regulation of EB1 turnover at microtubule plus ends by interaction with microtubule-associated protein ATIP3.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26485573 2015 Cep169, a Novel Microtubule Plus-End-Tracking Centrosomal Protein, Binds to CDK5RAP2 and Regulates Microtubule Stability.
26342024 2015 MAPRE1 as a plasma biomarker for early-stage colorectal cancer and adenomas.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
More...