Property Summary

NCBI Gene PubMed Count 107
PubMed Score 39.88
PubTator Score 231.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma 1.100 2.4e-27
atypical teratoid / rhabdoid tumor 1.200 3.3e-04
breast carcinoma 1.500 1.9e-03
dermatomyositis 1.200 3.0e-03
ependymoma 1.400 1.5e-14
glioblastoma 1.200 2.2e-07
group 3 medulloblastoma 1.200 2.4e-03
juvenile dermatomyositis 1.050 1.8e-11
medulloblastoma, large-cell 1.500 2.6e-04
Multiple myeloma 1.501 5.5e-04
oligodendroglioma 1.100 3.3e-10
osteosarcoma 1.053 1.7e-03
ovarian cancer 2.000 1.5e-04
pediatric high grade glioma 1.100 8.6e-06
primitive neuroectodermal tumor 1.200 1.9e-06
Waldenstrons macroglobulinemia 1.092 1.1e-02

Protein-protein Interaction (10)

PDB (27)

Gene RIF (59)

AA Sequence

MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHE      1 - 70
YIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPS     71 - 140
LVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDL    141 - 210
EKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY                211 - 268
//

Text Mined References (120)

PMID Year Title