Property Summary

NCBI Gene PubMed Count 61
Grant Count 8
R01 Count 3
Funding $720,982.03
PubMed Score 112.49
PubTator Score 80.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.886 0.000
group 4 medulloblastoma -1.400 0.000

Gene RIF (35)

PMID Text
26227166 our data establish the importance of a novel tumor suppressive IKBB gene in abrogating angiogenesis in NPC via the NF-kappaB signalling pathway.
25613138 The gene expression of NFKBIB is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25326706 NFKBIBrs3136641TT single nucleotide polymorphism was associated with a significantly decreased risk of developing wheezing.
23453579 The gene expression of NFKBIB is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20801175 The gene expression of NFKBIB is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
20716621 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20448286 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20140262 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDTALHLAVIHQH      1 - 70
EPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAH     71 - 140
ACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALYPDSDLEKEEEESEEDWKLQLEAENYEGHTP    141 - 210
LHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPLGS    211 - 280
AMLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRSQTRLPPTPASKPLP    281 - 350
DDPRPV                                                                    351 - 356
//

Text Mined References (65)

PMID Year Title
26227166 2016 IKBB tumor suppressive role in nasopharyngeal carcinoma via NF-?B-mediated signalling.
25416956 2014 A proteome-scale map of the human interactome network.
25326706 2014 Genetic polymorphisms and risk of recurrent wheezing in pediatric age.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24973451 2014 Dengue viral protease interaction with NF-?B inhibitor ?/? results in endothelial cell apoptosis and hemorrhage development.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23675531 2013 DDRGK1 regulates NF-?B activity by modulating I?B? stability.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20716621 2010 Genetic polymorphisms in adaptive immunity genes and childhood acute lymphoblastic leukemia.
More...