Property Summary

NCBI Gene PubMed Count 61
PubMed Score 113.84
PubTator Score 80.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 9.6e-08
group 4 medulloblastoma 1855 1.3e-04
Disease Target Count Z-score Confidence
ulnar-mammary syndrome 8 3.374 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma -1.400 1.3e-04
osteosarcoma -1.886 9.6e-08

Protein-protein Interaction (7)

Gene RIF (35)

AA Sequence

MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDTALHLAVIHQH      1 - 70
EPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAH     71 - 140
ACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALYPDSDLEKEEEESEEDWKLQLEAENYEGHTP    141 - 210
LHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPLGS    211 - 280
AMLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRSQTRLPPTPASKPLP    281 - 350
DDPRPV                                                                    351 - 356
//

Text Mined References (65)

PMID Year Title