Property Summary

NCBI Gene PubMed Count 84
Grant Count 85
R01 Count 54
Funding $4,971,700.53
PubMed Score 90.17
PubTator Score 70.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.900 0.000
ovarian cancer -1.100 0.000

Gene

PDB

1F3V   1F2H  

Gene RIF (40)

PMID Text
26475675 The release of extracellular vesicles was triggered by TNFA from BEAS-2b cells.TNFA-triggered extracellular vesicles contained TNFR1 and TRADD.
25791120 NPM-RAR binding to TRADD selectively inhibits caspase activation, while allowing activation of NFkappaB and JNK
25732226 MicroRNA-30c-2-3p negatively regulates NF-kappaB signaling and cell cycle progression through downregulation of TRADD and CCNE1 in breast cancer.
25643035 domains of calmodulin mediate FADD and TRADD interaction
25230327 PA induced the apoptosis of HUVECs by initiating the death pathway (TNF-R1/TRADD/caspases 8 pathway), whereas AA enhanced cell survival to protect vascular endothelial cells by activating the survival pathway (TNF-R1/RIP/NF-kappaB 50/NF-kappaB 65).
25033841 Biologic assessment found that NPM-RAR expression impaired TNF-induced signaling through TRADD, blunting TNF-mediated activation of caspase-3 (CASP3) and caspase-8 (CASP8), to ultimately block apoptosis.
24374337 we demonstrated that the association between DR6 and TRADD was enhanced upon DQM3 stimulation and TRADD was involved in DR6-induced signaling activation
24361886 structure-based mutations of TNFR-1 (P367A and P368A), TRADD (F266A), and RIP1 (M637A and R638A) disrupted formation of the death domain (DD) complex and prevented stable interactions among those DDs
24070137 TRADD gene expression was knocked down by an antisense oligonucleotide.
23982205 Data indicate that the ASK1-FoxO3a-TRADD-caspase 8 pathway is present in neural tube defects (NTDs)-affected tissues.
More...

AA Sequence

MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQ      1 - 70
LIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCIL     71 - 140
AQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPLQPPVPSLSEVKPPPPPPPAQTFLFQGQPVV    141 - 210
NRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRA    211 - 280
TLQRLVEALEENELTSLAEDLLGLTDPNGGLA                                          281 - 312
//

Text Mined References (86)

PMID Year Title
26475675 2015 TNF? triggers release of extracellular vesicles containing TNFR1 and TRADD, which can modulate TNF? responses of the parental cells.
25791120 2015 NPM-RAR binding to TRADD selectively inhibits caspase activation, while allowing activation of NF?B and JNK.
25732226 2015 MicroRNA-30c-2-3p negatively regulates NF-?B signaling and cell cycle progression through downregulation of TRADD and CCNE1 in breast cancer.
25643035 2015 N-terminal and C-terminal domains of calmodulin mediate FADD and TRADD interaction.
25230327 2015 Life and death of human vascular endothelial cells by stimulation with free fatty acids through death receptors.
25033841 2014 Extrinsic apoptosis is impeded by direct binding of the APL fusion protein NPM-RAR to TRADD.
24374337 2014 Agonist antibody activates death receptor 6 downstream signaling involving TRADD recruitment.
24361886 2014 Death domain complex of the TNFR-1, TRADD, and RIP1 proteins for death-inducing signaling.
24070137 2013 Anticancer activity of an antisense oligonucleotide targeting TRADD combined with proteasome inhibitors in chemoresistant hepatocellular carcinoma cells.
23982205 2013 Maternal hyperglycemia activates an ASK1-FoxO3a-caspase 8 pathway that leads to embryonic neural tube defects.
More...