Property Summary

NCBI Gene PubMed Count 90
PubMed Score 97.06
PubTator Score 70.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.1e-06
psoriasis 6694 3.1e-05
Disease Target Count Z-score Confidence
Cancer 2499 3.599 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.100 1.1e-06
psoriasis 1.900 3.1e-05

Gene RIF (42)

AA Sequence

MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQ      1 - 70
LIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCIL     71 - 140
AQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPLQPPVPSLSEVKPPPPPPPAQTFLFQGQPVV    141 - 210
NRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRA    211 - 280
TLQRLVEALEENELTSLAEDLLGLTDPNGGLA                                          281 - 312
//

Text Mined References (93)

PMID Year Title