Property Summary

NCBI Gene PubMed Count 232
PubMed Score 441.48
PubTator Score 531.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Keratoconus 113 4.66 2.3
Disease Target Count Z-score Confidence
Amyloidosis 67 3.022 1.5
Disease Target Count Z-score Confidence
Recurrent corneal erosion 7 5.083 2.5
Corneal edema 14 3.322 1.7

Expression

  Differential Expression (31)

Disease log2 FC p
active Crohn's disease 3.747 7.7e-04
active ulcerative colitis 3.995 3.3e-03
adult high grade glioma 1.500 3.4e-03
Astrocytoma, Pilocytic 1.200 9.2e-03
atypical teratoid / rhabdoid tumor 1.400 3.5e-03
Becker muscular dystrophy 1.306 1.8e-04
Chronic Lymphocytic Leukemia 1.979 1.1e-02
colon cancer 3.900 1.9e-03
Duchenne muscular dystrophy 1.572 5.4e-10
Endometriosis 1.798 2.2e-02
ependymoma 3.200 1.1e-02
esophageal adenocarcinoma 1.200 2.3e-02
gastric carcinoma 1.800 7.8e-03
glioblastoma 1.800 7.7e-04
group 3 medulloblastoma 2.300 7.0e-04
interstitial lung disease 1.500 3.8e-02
intraductal papillary-mucinous adenoma (... -1.300 1.4e-02
juvenile dermatomyositis 1.086 1.2e-09
limb girdle muscular dystrophy 2A 1.326 9.4e-07
lung cancer 3.500 1.5e-06
lung carcinoma -1.800 8.5e-22
malignant mesothelioma -4.300 7.7e-10
medulloblastoma, large-cell 1.200 1.1e-02
oligodendroglioma 1.600 2.8e-02
ovarian cancer -1.900 2.0e-06
pancreatic cancer 1.400 5.3e-04
Pick disease 1.400 2.5e-02
pituitary cancer -1.700 3.3e-04
primary pancreatic ductal adenocarcinoma 2.510 3.0e-04
psoriasis -1.100 4.5e-06
subependymal giant cell astrocytoma 2.728 1.7e-02

Gene RIF (188)

AA Sequence

MALFVRLLALALALALGPAATLAGPAKSPYQLVLQHSRLRGRQHGPNVCAVQKVIGTNRKYFTNCKQWYQ      1 - 70
RKICGKSTVISYECCPGYEKVPGEKGCPAALPLSNLYETLGVVGSTTTQLYTDRTEKLRPEMEGPGSFTI     71 - 140
FAPSNEAWASLPAEVLDSLVSNVNIELLNALRYHMVGRRVLTDELKHGMTLTSMYQNSNIQIHHYPNGIV    141 - 210
TVNCARLLKADHHATNGVVHLIDKVISTITNNIQQIIEIEDTFETLRAAVAASGLNTMLEGNGQYTLLAP    211 - 280
TNEAFEKIPSETLNRILGDPEALRDLLNNHILKSAMCAEAIVAGLSVETLEGTTLEVGCSGDMLTINGKA    281 - 350
IISNKDILATNGVIHYIDELLIPDSAKTLFELAAESDVSTAIDLFRQAGLGNHLSGSERLTLLAPLNSVF    351 - 420
KDGTPPIDAHTRNLLRNHIIKDQLASKYLYHGQTLETLGGKKLRVFVYRNSLCIENSCIAAHDKRGRYGT    421 - 490
LFTMDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTNEAFRALPPRERSRLLG    491 - 560
DAKELANILKYHIGDEILVSGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGVVHVITN    561 - 630
VLQPPANRPQERGDELADSALEIFKQASAFSRASQRSVRLAPVYQKLLERMKH                     631 - 683
//

Text Mined References (237)

PMID Year Title