Property Summary

NCBI Gene PubMed Count 223
PubMed Score 412.45
PubTator Score 531.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 8.48075660998745E-22
posterior fossa group A ependymoma 1511 1.95432720172868E-12
Duchenne muscular dystrophy 602 5.37108677653614E-10
malignant mesothelioma 3163 7.66991824108247E-10
juvenile dermatomyositis 1189 1.19017783378948E-9
limb girdle muscular dystrophy 2A 156 9.3686460080316E-7
lung cancer 4473 1.48570212633821E-6
ovarian cancer 8492 8.48637563183136E-6
Becker muscular dystrophy 187 1.82868041552029E-4
primary pancreatic ductal adenocarcinoma 1271 2.97241573640926E-4
pituitary cancer 1972 3.2562604400457E-4
pancreatic cancer 2300 3.36657793073764E-4
psoriasis 6685 3.3755975770595E-4
group 3 medulloblastoma 2254 7.04684814585988E-4
active Crohn's disease 918 7.73558218545843E-4
colon cancer 1475 0.00189588918432885
glioblastoma 5572 0.00225661163908221
active ulcerative colitis 477 0.00332053697417365
atypical teratoid / rhabdoid tumor 4369 0.00348973133807111
pediatric high grade glioma 2712 0.00385342109718664
gastric carcinoma 832 0.00776563070408494
pilocytic astrocytoma 3086 0.00924264803777868
medulloblastoma, large-cell 6234 0.0105030348141133
chronic lymphocytic leukemia 244 0.0112199491713193
intraductal papillary-mucinous adenoma (IPMA) 2956 0.01377930102253
subependymal giant cell astrocytoma 2287 0.0166174938551783
Endometriosis 535 0.0222115959935975
esophageal adenocarcinoma 737 0.0230512937469017
Pick disease 1893 0.0249676380617379
oligodendroglioma 2849 0.0279897714502165
interstitial lung disease 292 0.0375204137177873
Disease Target Count Z-score Confidence
Amyloidosis 68 3.054 1.5

Expression

Synonym

Accession Q15582 D3DQB1 O14471 O14472 O14476 O43216 O43217 O43218 O43219 Q53XM1 Beta ig-h3
Symbols CSD
CDB1
CDG2
CSD1
CSD2
CSD3
EBMD
LCD1
BIGH3
CDGG1

Gene

PANTHER Protein Class (1)

PDB

1X3B   2LTB   2LTC   2VXP  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid
Platypus EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (181)

PMID Text
26915797 TGFBIp expression is positively regulated by TGF-beta1 in corneal fibroblasts, whereas TGF-beta1-induced miR-21 and miR-181a negatively regulate TGFBIp expression.
26864644 LASIK surgery of granular corneal dystrophy type 2 patients leads to accumulation and differential proteolytic processing TGFBI protein.
26604660 No mutations were detected in the TGFBI gene in Korean patients with macular corneal dystrophy.
26553048 the functional role of H3K4me in TGFbeta1-mediated TGFBIp and ECM gene expression in corneal fibroblasts
26503734 We observed that knockdown of Cul4A was associated with increased sensitivity to gemcitabine through upregulation of TGFBI in lung cancer cells.
26464103 The p. Arg555Trp mutation of the TGFBI gene was associated with Thiel-Behnke corneal dystrophy, which revealed a novel phenotype-genotype correlation within the mutational spectrum of phenotypically diverse corneal dystrophies.
26288337 Data suggest that periostin and TGFBI (transforming growth factor-beta induced protein) can be considered paralogs in some ways: structural homology, phylogeny, and functions in extracellular matrix formation/cell adhesion/cellular immunity. [REVIEW]
26084452 Vicenin-2 and scolymoside could be a potential therapeutic agent for treatment of various severe vascular inflammatory diseases via inhibition of the TGFBIp signaling pathway.
25889002 TGFBI functions as a promoter of certain gastrointestinal tract cancers.
25864756 Betaig-h3 protein expressed distinctly in gastric cancer peritoneal metastasis.
More...

AA Sequence

MALFVRLLALALALALGPAATLAGPAKSPYQLVLQHSRLRGRQHGPNVCAVQKVIGTNRKYFTNCKQWYQ      1 - 70
RKICGKSTVISYECCPGYEKVPGEKGCPAALPLSNLYETLGVVGSTTTQLYTDRTEKLRPEMEGPGSFTI     71 - 140
FAPSNEAWASLPAEVLDSLVSNVNIELLNALRYHMVGRRVLTDELKHGMTLTSMYQNSNIQIHHYPNGIV    141 - 210
TVNCARLLKADHHATNGVVHLIDKVISTITNNIQQIIEIEDTFETLRAAVAASGLNTMLEGNGQYTLLAP    211 - 280
TNEAFEKIPSETLNRILGDPEALRDLLNNHILKSAMCAEAIVAGLSVETLEGTTLEVGCSGDMLTINGKA    281 - 350
IISNKDILATNGVIHYIDELLIPDSAKTLFELAAESDVSTAIDLFRQAGLGNHLSGSERLTLLAPLNSVF    351 - 420
KDGTPPIDAHTRNLLRNHIIKDQLASKYLYHGQTLETLGGKKLRVFVYRNSLCIENSCIAAHDKRGRYGT    421 - 490
LFTMDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTNEAFRALPPRERSRLLG    491 - 560
DAKELANILKYHIGDEILVSGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGVVHVITN    561 - 630
VLQPPANRPQERGDELADSALEIFKQASAFSRASQRSVRLAPVYQKLLERMKH                     631 - 683
//

Text Mined References (227)

PMID Year Title
26915797 2016 TGF-? regulates TGFBIp expression in corneal fibroblasts via miR-21, miR-181a, and Smad signaling.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26864644 2016 LASIK surgery of granular corneal dystrophy type 2 patients leads to accumulation and differential proteolytic processing of transforming growth factor beta-induced protein (TGFBIp).
26604660 2015 Molecular analysis of the CHST6 gene in Korean patients with macular corneal dystrophy: Identification of three novel mutations.
26553048 2015 Histone methylation levels correlate with TGFBIp and extracellular matrix gene expression in normal and granular corneal dystrophy type 2 corneal fibroblasts.
26503734 2015 Knockdown of Cul4A increases chemosensitivity to gemcitabine through upregulation of TGFBI in lung cancer cells.
26464103 2015 A novel phenotype-genotype correlation with an Arg555Trp mutation of TGFBI gene in Thiel-Behnke corneal dystrophy in a Chinese pedigree.
26288337 2015 Periostin and TGF-?-induced protein: Two peas in a pod?
26273833 2015 Absence of Vitamin K-Dependent ?-Carboxylation in Human Periostin Extracted from Fibrotic Lung or Secreted from a Cell Line Engineered to Optimize ?-Carboxylation.
26084452 2015 Ameliorative Effect of Vicenin-2 and Scolymoside on TGFBIp-Induced Septic Responses.
More...