Property Summary

NCBI Gene PubMed Count 27
PubMed Score 4.10
PubTator Score 42.15

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.731 0.000
group 4 medulloblastoma 1.100 0.001
ovarian cancer -1.700 0.000

Synonym

Accession Q15572 B7Z5K5 B7Z5S4 B7Z908 B7Z9L7 Q59F67 Q8N6V3
Symbols SL1
TAFI95
TAFI110
MGC:39976

Gene

 GWAS Trait (1)

Gene RIF (6)

PMID Text
26023773 hCdc14B promotes reactivation of rDNA transcription by dephosphorylating TAFI110. SIRT1 becomes transiently enriched in nucleoli at the onset of mitosis. SIRT1 deacetylates TAFI68 destabilizing SL1 binding to the rDNA promoter
25551296 Our results indicate that TAF1C gene harboured not only somatic frameshift mutations but also the mutational ITH, which together might play a role in tumourigenesis of gastric and colorectal cancer.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20663923 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16055704 PTEN represses RNA Pol I transcription through a novel mechanism that involves disruption of the SL1 complex
15970593 SL1 directs preinitiation complex formation, functioning in core promoter binding, RNA polymerase I recruitment, and UBF stabilization.

AA Sequence

MDFPSSLRPALFLTGPLGLSDVPDLSFMCSWRDALTLPEAQPQNSENGALHVTKDLLWEPATPGPLPMLP      1 - 70
PLIDPWDPGLTARDLLFRGGCRYRKRPRVVLDVTEQISRFLLDHGDVAFAPLGKLMLENFKLEGAGSRTK     71 - 140
KKTVVSVKKLLQDLGGHQPWGCPWAYLSNRQRRFSILGGPILGTSVASHLAELLHEELVLRWEQLLLDEA    141 - 210
CTGGALAWVPGRTPQFGQLVYPAGGAQDRLHFQEVVLTPGDNPQFLGKPGRIQLQGPVRQVVTCTVQGES    211 - 280
KALIYTFLPHWLTCYLTPGPFHPSSALLAVRSDYHCAVWKFGKQWQPTLLQAMQVEKGATGISLSPHLPG    281 - 350
ELAICSRSGAVCLWSPEDGLRQIYRDPETLVFRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPPGCG    351 - 420
LLLFRLGAEASCQKGERVLLTQYLGHSSPKCLPPTLHLVCTQFSLYLVDERLPLVPMLKWNHGLPSPLLL    421 - 490
ARLLPPPRPSCVQPLLLGGQGGQLQLLHLAGEGASVPRLAGPPQSLPSRIDSLPAFPLLEPKIQWRLQER    491 - 560
LKAPTIGLAAVVPPLPSAPTPGLVLFQLSAAGDVFYQQLRPQVDSSLRRDAGPPGDTQPDCHAPTASWTS    561 - 630
QDTAGCSQWLKALLKVPLAPPVWTAPTFTHRQMLGSTELRREEEEGQRLGVLRKAMARGQLLLQRDLGSL    631 - 700
PAAEPPPAPESGLEDKLSERLGEAWAGRGAAWWERQQGRTSEPGRQTRRPKRRTQLSSSFSLSGHVDPSE    701 - 770
DTSSPHSPEWPPADALPLPPTTPPSQELTPDACAQGVPSEQRQMLRDYMAKLPPQRDTPGCATTPPHSQA    771 - 840
SSVRATRSQQHTPVLSSSQPLRKKPRMGF                                             841 - 869
//

Text Mined References (32)

PMID Year Title
26023773 2015 Cooperative Action of Cdk1/cyclin B and SIRT1 Is Required for Mitotic Repression of rRNA Synthesis.
25551296 2015 Frameshift mutations of TAF1C gene, a core component for transcription by RNA polymerase I, and its regional heterogeneity in gastric and colorectal cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22843504 2012 Individual common variants exert weak effects on the risk for autism spectrum disorders.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22368283 2012 Human PIH1 associates with histone H4 to mediate the glucose-dependent enhancement of pre-rRNA synthesis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20663923 2010 A genome-wide scan for common alleles affecting risk for autism.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
More...