Property Summary

NCBI Gene PubMed Count 20
Grant Count 67
R01 Count 43
Funding $9,795,401.82
PubMed Score 50.96
PubTator Score 37.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.100 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.100 0.010
medulloblastoma, large-cell -2.100 0.001
intraductal papillary-mucinous carcinoma... -2.000 0.000
adult high grade glioma -1.400 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q15560 B3KNM1 Q8TD37 Q8TD38
Symbols TFIIS

Gene

PANTHER Protein Class (1)

PDB

2LW4  

Gene RIF (5)

PMID Text
17374514 SII is important for preventing cellular death due to oxidative DNA damage, assisting RNAPII to bypass 8-oxoG
16214896 data suggest that because TFIIS promotes escape from promoter-proximal pauses by stimulating cleavage of back-tracked nascent RNA, TFIIS inhibition may help DSIF/NELF negatively regulate productive transcription
12034815 RNA polymerase II complexes in the very early phase of transcription are not susceptible to TFIIS-induced exonucleolytic cleavage.
9765201 TFIIS synergizes with HIV-1 Tat during transactivation of the HIV-1 LTR promoter
1559613 TFIIS synergizes with HIV-1 Tat during transactivation of the HIV-1 LTR promoter

AA Sequence

MMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPITLHLLQSTRVGMSVNALRKQSSDEEVIALAK      1 - 70
SLIKSWKKLLDASDAKARERGRGMPLPTSSRDASEAPDPSRKRPELPRAPSTPRITTFPPVPVTCDAVRN     71 - 140
KCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLC    141 - 210
GAITPQQIAVMTSEEMASDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCGKCRKKNCTYTQVQTRSSD    211 - 280
EPMTTFVVCNECGNRWKFC                                                       281 - 299
//

Text Mined References (23)

PMID Year Title
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
18655026 2008 Proteomic analysis of ubiquitinated proteins in normal hepatocyte cell line Chang liver cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17374514 2007 RNA polymerase II bypasses 8-oxoguanine in the presence of transcription elongation factor TFIIS.
16214896 2005 A negative elongation factor for human RNA polymerase II inhibits the anti-arrest transcript-cleavage factor TFIIS.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
More...