Property Summary

NCBI Gene PubMed Count 20
PubMed Score 52.72
PubTator Score 37.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.400 3.0e-06
atypical teratoid / rhabdoid tumor -1.400 5.9e-06
glioblastoma -1.100 1.0e-02
intraductal papillary-mucinous carcinoma... -2.000 6.2e-06
medulloblastoma, large-cell -2.100 9.8e-04
ovarian cancer -1.200 5.3e-04
psoriasis -1.100 2.8e-07

Gene RIF (5)

AA Sequence

MMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPITLHLLQSTRVGMSVNALRKQSSDEEVIALAK      1 - 70
SLIKSWKKLLDASDAKARERGRGMPLPTSSRDASEAPDPSRKRPELPRAPSTPRITTFPPVPVTCDAVRN     71 - 140
KCREMLTAALQTDHDHVAIGADCERLSAQIEECIFRDVGNTDMKYKNRVRSRISNLKDAKNPDLRRNVLC    141 - 210
GAITPQQIAVMTSEEMASDELKEIRKAMTKEAIREHQMARTGGTQTDLFTCGKCRKKNCTYTQVQTRSSD    211 - 280
EPMTTFVVCNECGNRWKFC                                                       281 - 299
//

Text Mined References (23)

PMID Year Title