Property Summary

NCBI Gene PubMed Count 8
Grant Count 166
R01 Count 81
Funding $36,760,376.94
PubMed Score 3428.94
PubTator Score 85.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Synonym

Accession Q15546 B2R6X9 D3DTY6 Q8TAN7
Symbols MMA
MMD1
PAQR11

Gene

MMD

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
24971538 Together, our results highlight the significance of miR-140-5p/MMD axis in lung cancer, and miR-140-5p/MMD axis could serve as new molecular targets for the therapy against lung cancer.
21968647 this study uncovers a new paradigm of spatial regulation of Ras signaling in the Golgi apparatus by PAQR10 and PAQR11.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLC      1 - 70
ALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGT     71 - 140
IYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGIIPFAHAIWHL    141 - 210
FVATAAAVHYYAIWKYLYRSPTDFMRHL                                              211 - 238
//

Text Mined References (9)

PMID Year Title
24971538 2014 Monocyte to macrophage differentiation-associated (MMD) targeted by miR-140-5p regulates tumor growth in non-small cell lung cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21968647 2012 PAQR10 and PAQR11 mediate Ras signaling in the Golgi apparatus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
16044242 2005 PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7503749 1995 Molecular cloning of a novel macrophage maturation-associated transcript encoding a protein with several potential transmembrane domains.