Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3663.77
PubTator Score 85.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (27)

Disease log2 FC p
acute quadriplegic myopathy 1.363 6.7e-06
adrenocortical carcinoma -1.049 1.8e-02
astrocytic glioma -2.000 4.2e-03
atypical teratoid / rhabdoid tumor -2.100 1.0e-05
autosomal dominant Emery-Dreifuss muscul... 2.008 4.7e-03
breast carcinoma -1.900 2.6e-03
dermatomyositis 1.600 1.6e-03
Duchenne muscular dystrophy 1.064 1.4e-03
ductal carcinoma in situ -2.200 1.2e-03
ependymoma -2.500 8.0e-03
fibroadenoma -3.100 1.0e-02
gastric carcinoma 2.500 4.1e-03
glioblastoma -1.500 3.8e-03
interstitial cystitis 1.600 1.8e-02
intraductal papillary-mucinous adenoma (... -1.500 3.2e-02
invasive ductal carcinoma 1.510 3.5e-05
lung carcinoma -1.600 1.1e-19
malignant mesothelioma -1.600 1.3e-06
medulloblastoma -1.200 2.7e-02
medulloblastoma, large-cell -1.200 2.8e-02
oligodendroglioma -1.800 6.6e-03
osteosarcoma -1.186 2.5e-02
ovarian cancer 1.600 3.1e-02
pancreatic cancer 1.500 5.7e-04
pancreatic carcinoma 1.500 5.7e-04
primary pancreatic ductal adenocarcinoma 1.716 1.8e-03
ulcerative colitis 1.100 2.6e-05

Synonym

Accession Q15546 B2R6X9 D3DTY6 Q8TAN7
Symbols MMA
MMD1
PAQR11

Gene

MMD

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKITAWIYGMGLC      1 - 70
ALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRELGPLASHMRWFIWLMAAGGT     71 - 140
IYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGGLIYCLGVVFFKSDGIIPFAHAIWHL    141 - 210
FVATAAAVHYYAIWKYLYRSPTDFMRHL                                              211 - 238
//

Text Mined References (10)

PMID Year Title