Property Summary

NCBI Gene PubMed Count 66
PubMed Score 1709.51
PubTator Score 130.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Peeling skin syndrome 17 5.595 2.8
hypotrichosis 2 1 0.0 0.0
Disease Target Count P-value
periodontitis 293 3.7e-12
ovarian cancer 8520 7.3e-11
osteosarcoma 7950 3.8e-07
malignant mesothelioma 3232 3.1e-06
medulloblastoma, large-cell 6241 1.0e-04
diabetes mellitus 1728 1.3e-03
psoriasis 6694 1.5e-03
Atopic dermatitis 952 2.4e-03
Disease Target Count Z-score Confidence
ENSP00000256078 30 0.0 0.5
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 4.606 2.3
Multiple Sclerosis 540 0.0 3.0
Disease Target Count Z-score Confidence
Hypotrichosis 47 0.0 4.0

Gene RIF (27)

AA Sequence

MGSSRAPWMGRVGGHGMMALLLAGLLLPGTLAKSIGTFSDPCKDPTRITSPNDPCLTGKGDSSGFSSYSG      1 - 70
SSSSGSSISSARSSGGGSSGSSSGSSIAQGGSAGSFKPGTGYSQVSYSSGSGSSLQGASGSSQLGSSSSH     71 - 140
SGNSGSHSGSSSSHSSSSSSFQFSSSSFQVGNGSALPTNDNSYRGILNPSQPGQSSSSSQTSGVSSSGQS    141 - 210
VSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPGVVQGPPCSNGGLPG    211 - 280
KPCPPITSVDKSYGGYEVVGGSSDSYLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKY    281 - 350
FSSNPIIPSQSAASSAIAFQPVGTGGVQLCGGGSTGSKGPCSPSSSRVPSSSSISSSSGSPYHPCGSASQ    351 - 420
SPCSPPGTGSFSSSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSS    421 - 490
AGKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLDSP                                   491 - 529
//

Text Mined References (68)

PMID Year Title