Property Summary

NCBI Gene PubMed Count 45
Grant Count 9
R01 Count 9
Funding $495,752.03
PubMed Score 16.01
PubTator Score 14.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
oligodendroglioma 1.200 0.011
psoriasis -1.600 0.000
osteosarcoma -1.833 0.000
astrocytoma 1.500 0.001
glioblastoma 1.100 0.002
medulloblastoma, large-cell 1.500 0.000
acute quadriplegic myopathy 1.158 0.000
subependymal giant cell astrocytoma -1.136 0.019
ovarian cancer -1.400 0.000

Gene RIF (8)

PMID Text
26498691 Polymorphisms in SF3A1 gene is associated with pancreatic cancer.
26079486 SF3A1 polymorphisms are not associated with Colorectal Cancer Risk.
25403181 show that U1-SL4 interacts with the SF3A1 protein of the U2 snRNP
24204290 the SF3A mRNA splicing complex controls production of a negative regulator of TLR signaling that limits the extent of innate immune activation.
22174317 HIV-1 Rev interacting protein, splicing factor 3a, subunit 1 (SF3A1), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with SF3A1 is increased by RRE
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18854154 Knockdown of splicing factor 3a, subunit 1 (SF3A1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
15647371 SF3a60, 66, and 120, but not SF1, are essential for pre-mRNA splicing

AA Sequence

MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEAR      1 - 70
IRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQET     71 - 140
IVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTK    141 - 210
LVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFV    211 - 280
VVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDT    281 - 350
QVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKI    351 - 420
PASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGE    421 - 490
EEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPP    491 - 560
SSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVP    561 - 630
MPPSAPPIMAPRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRR    631 - 700
NKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSL    701 - 770
AYYNMANGAVIHLALKERGGRKK                                                   771 - 793
//

Text Mined References (61)

PMID Year Title
26498691 2015 SF3A1 and pancreatic cancer: new evidence for the association of the spliceosome and cancer.
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26079486 2015 The Associations between RNA Splicing Complex Gene SF3A1 Polymorphisms and Colorectal Cancer Risk in a Chinese Population.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25403181 2014 Stem-loop 4 of U1 snRNA is essential for splicing and interacts with the U2 snRNP-specific SF3A1 protein during spliceosome assembly.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25092791 2014 Sororin pre-mRNA splicing is required for proper sister chromatid cohesion in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24204290 2013 Limiting of the innate immune response by SF3A-dependent control of MyD88 alternative mRNA splicing.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
More...