Property Summary

NCBI Gene PubMed Count 47
PubMed Score 16.19
PubTator Score 14.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
acute quadriplegic myopathy 1.158 2.3e-06
astrocytoma 1.200 8.4e-04
glioblastoma 1.100 1.6e-03
medulloblastoma, large-cell 1.500 2.1e-04
oligodendroglioma 1.100 1.2e-02
osteosarcoma -1.833 2.2e-05
ovarian cancer -1.400 1.2e-05
psoriasis -1.600 6.5e-05
subependymal giant cell astrocytoma -1.136 1.9e-02

 GO Function (1)

Gene RIF (8)

AA Sequence

MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEAR      1 - 70
IRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQET     71 - 140
IVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTK    141 - 210
LVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFV    211 - 280
VVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDT    281 - 350
QVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKI    351 - 420
PASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGE    421 - 490
EEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPP    491 - 560
SSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVP    561 - 630
MPPSAPPIMAPRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRR    631 - 700
NKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSL    701 - 770
AYYNMANGAVIHLALKERGGRKK                                                   771 - 793
//

Text Mined References (63)

PMID Year Title