Property Summary

NCBI Gene PubMed Count 26
PubMed Score 63.96
PubTator Score 2207.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.47181904771804E-5
group 3 medulloblastoma 2254 6.73567367217709E-5
medulloblastoma, large-cell 6234 3.02916665497268E-4
ovarian cancer 8492 8.65406448154712E-4
psoriasis 6685 0.00129958199704128
subependymal giant cell astrocytoma 2287 0.0332559923104815
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0
Disease Target Count Z-score Confidence
Dental caries 67 5.862 2.9

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.200 0.001
atypical teratoid / rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.400 0.000
group 3 medulloblastoma 1.200 0.000
subependymal giant cell astrocytoma 1.153 0.033
ovarian cancer 1.200 0.001

Synonym

Accession Q15397 A8K804 Q547G7 Q5SZY9 Q6IB47 Q96B27 Q96L78 Q96L79 Q96L80
Symbols PEN
HA-8
PUF6
XTP5
PUF-A
HLA-HA8
KIAA0020

Gene

PDB

4WZR   4WZW  

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
C. elegans OMA Inparanoid
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Pathway (1)

Gene RIF (4)

PMID Text
23480177 Results indicate that mismatches in minor H antigens HA-8 (KIAA0020) and ACC-1 (BCL2A1) predisposed to chronic graft-versus-host disease (GvHD).
20353833 Observational study of gene-disease association. (HuGE Navigator)
18093280 Observational study of gene-disease association. (HuGE Navigator)
17558408 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MEVKGKKQFTGKSTKTAQEKNRFHKNSDSGSSKTFPTRKVAKEGGPKVTSRNFEKSITKLGKKGVKQFKN      1 - 70
KQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKWDDFKKKKKELKQSRQLSDKTNYDIVVRAKQ     71 - 140
MWEILRRKDCDKEKRVKLMSDLQKLIQGKIKTIAFAHDSTRVIQCYIQYGNEEQRKQAFEELRDDLVELS    141 - 210
KAKYSRNIVKKFLMYGSKPQIAEIIRSFKGHVRKMLRHAEASAIVEYAYNDKAILEQRNMLTEELYGNTF    211 - 280
QLYKSADHRTLDKVLEVQPEKLELIMDEMKQILTPMAQKEAVIKHSLVHKVFLDFFTYAPPKLRSEMIEA    281 - 350
IREAVVYLAHTHDGARVAMHCLWHGTPKDRKVIVKTMKTYVEKVANGQYSHLVLLAAFDCIDDTKLVKQI    351 - 420
IISEIISSLPSIVNDKYGRKVLLYLLSPRDPAHTVREIIEVLQKGDGNAHSKKDTEVRRRELLESISPAL    421 - 490
LSYLQEHAQEVVLDKSACVLVSDILGSATGDVQPTMNAIASLAATGLHPGGKDGELHIAEHPAGHLVLKW    491 - 560
LIEQDKKMKENGREGCFAKTLVEHVGMKNLKSWASVNRGAIILSSLLQSCDLEVANKVKAALKSLIPTLE    561 - 630
KTKSTSKGIEILLEKLST                                                        631 - 648
//

Text Mined References (27)

PMID Year Title
25512524 2014 A divergent Pumilio repeat protein family for pre-rRNA processing and mRNA localization.
24058526 2013 Genome-wide meta-analysis of systolic blood pressure in children with sickle cell disease.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23480177 2013 Minor histocompatibility antigens as determinants for graft-versus-host disease after allogeneic haematopoietic stem cell transplantation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21266351 2011 hPuf-A/KIAA0020 modulates PARP-1 cleavage upon genotoxic stress.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
20353833 2010 Degree of predicted minor histocompatibility antigen mismatch correlates with poorer clinical outcomes in nonmyeloablative allogeneic hematopoietic cell transplantation.
More...