Property Summary

NCBI Gene PubMed Count 26
PubMed Score 69.75
PubTator Score 2207.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.5e-05
group 3 medulloblastoma 1.200 6.7e-05
medulloblastoma, large-cell 1.400 3.0e-04
ovarian cancer 1.200 8.7e-04
psoriasis 1.200 1.3e-03
subependymal giant cell astrocytoma 1.153 3.3e-02

Gene RIF (4)

AA Sequence

MEVKGKKQFTGKSTKTAQEKNRFHKNSDSGSSKTFPTRKVAKEGGPKVTSRNFEKSITKLGKKGVKQFKN      1 - 70
KQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKWDDFKKKKKELKQSRQLSDKTNYDIVVRAKQ     71 - 140
MWEILRRKDCDKEKRVKLMSDLQKLIQGKIKTIAFAHDSTRVIQCYIQYGNEEQRKQAFEELRDDLVELS    141 - 210
KAKYSRNIVKKFLMYGSKPQIAEIIRSFKGHVRKMLRHAEASAIVEYAYNDKAILEQRNMLTEELYGNTF    211 - 280
QLYKSADHRTLDKVLEVQPEKLELIMDEMKQILTPMAQKEAVIKHSLVHKVFLDFFTYAPPKLRSEMIEA    281 - 350
IREAVVYLAHTHDGARVAMHCLWHGTPKDRKVIVKTMKTYVEKVANGQYSHLVLLAAFDCIDDTKLVKQI    351 - 420
IISEIISSLPSIVNDKYGRKVLLYLLSPRDPAHTVREIIEVLQKGDGNAHSKKDTEVRRRELLESISPAL    421 - 490
LSYLQEHAQEVVLDKSACVLVSDILGSATGDVQPTMNAIASLAATGLHPGGKDGELHIAEHPAGHLVLKW    491 - 560
LIEQDKKMKENGREGCFAKTLVEHVGMKNLKSWASVNRGAIILSSLLQSCDLEVANKVKAALKSLIPTLE    561 - 630
KTKSTSKGIEILLEKLST                                                        631 - 648
//

Text Mined References (27)

PMID Year Title