Property Summary

NCBI Gene PubMed Count 78
Grant Count 48
R01 Count 27
Funding $5,772,970.87
PubMed Score 76.35
PubTator Score 82.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (45)

PMID Text
26896798 alphaCP1/ alphaCP2 binding to a cytosine-rich subset of polypyrimidine tracts drives a novel pathway of cassette exon splicing in the mammalian transcriptome.
26803058 beta2-adrenergic receptor signaling promotes pancreatic ductal adenocarcinoma progression by facilitating PCBP2-dependent c-myc expression.
26722446 our data indicate that miR-214 may function as tumor suppressor in glioma by targeting PCBP2
26116532 PCBP2 knockdown promoted angiotensin II-induced hypertrophy (increase in cell size, protein synthesis and activation of fetal genes) of cardiomyocytes, while PCBP2 overexpression obtained oppose effects.
26002461 Protein and mRNA levels of PCBP2 were down-regulated under insulin-resistant conditions. Over-expression of PCBP2 inhibits HIF1alpha and STAT3 pathway.
25717101 STAT3 functions via cellular PCBP2 to regulate B-cell lytic susceptibility by restraining Epstein-Barr Virus lytic activation.
25496916 Poly(rC) binding protein 2 (PCBP2) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24843120 PCBP1 and PCBP2 may serve as iron chaperones to multiple classes of cytosolic nonheme iron enzymes and may have a particular role in restoring metal cofactors that are spontaneously lost in iron deficient cells.
24796666 PCBP2-depletion induces apoptosis in gastric cancer cells via up-regulating expression of pro-apoptotic proteins and down-regulating anti-apoptotic proteins. miR-34a is a target of PCBP2, and miR-34a is critically essential for the function of PCBP2.
24607900 SIRT6 inhibits glioma cell proliferation and colony formation in vitro and glioma cell growth in vivo in a PCBP2 dependent manner. SIRT6 inhibits PCBP2 expression through deacetylating H3K9ac and SIRT6 acts as a tumor suppressor in glioma.
More...

AA Sequence

MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFK      1 - 70
AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN     71 - 140
STERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFP    141 - 210
HTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWG    211 - 280
LDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYL    281 - 350
INVRLSSETGGMGSS                                                           351 - 365
//

Text Mined References (90)

PMID Year Title
26896798 2016 ?CP binding to a cytosine-rich subset of polypyrimidine tracts drives a novel pathway of cassette exon splicing in the mammalian transcriptome.
26803058 2016 ?2-adrenergic receptor signaling promotes pancreatic ductal adenocarcinoma (PDAC) progression through facilitating PCBP2-dependent c-myc expression.
26722446 2015 MicroRNA-214 targets PCBP2 to suppress the proliferation and growth of glioma cells.
26116532 2015 The RNA-binding protein PCBP2 inhibits Ang II-induced hypertrophy of cardiomyocytes though promoting GPR56 mRNA degeneration.
26002461 2015 PCBP2 regulates hepatic insulin sensitivity via HIF-1? and STAT3 pathway in HepG2 cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25717101 2015 Cellular STAT3 functions via PCBP2 to restrain Epstein-Barr Virus lytic activation in B lymphocytes.
25416956 2014 A proteome-scale map of the human interactome network.
24843120 2014 Iron chaperones PCBP1 and PCBP2 mediate the metallation of the dinuclear iron enzyme deoxyhypusine hydroxylase.
24796666 2014 The RNA-binding protein PCBP2 facilitates gastric carcinoma growth by targeting miR-34a.
More...