Property Summary

NCBI Gene PubMed Count 86
PubMed Score 82.32
PubTator Score 82.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Alzheimer's disease 1.100 2.4e-02
atypical teratoid / rhabdoid tumor 1.200 2.3e-03
intraductal papillary-mucinous carcinoma... 1.200 2.6e-04
medulloblastoma, large-cell 1.600 9.3e-04
osteosarcoma -1.780 1.9e-05
Pick disease 1.900 2.9e-07
Rheumatoid arthritis 1.200 2.6e-02

Gene RIF (53)

AA Sequence

MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFK      1 - 70
AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN     71 - 140
STERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFP    141 - 210
HTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWG    211 - 280
LDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYL    281 - 350
INVRLSSETGGMGSS                                                           351 - 365
//

Text Mined References (99)

PMID Year Title