Property Summary

NCBI Gene PubMed Count 78
PubMed Score 76.35
PubTator Score 82.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Pick disease 1893 2.87360396577229E-7
osteosarcoma 7933 3.085282600679E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.56867788093291E-4
medulloblastoma, large-cell 6234 9.28508637800269E-4
atypical teratoid / rhabdoid tumor 4369 0.00225404644589216
Alzheimer's disease 644 0.0235786901691737
Rheumatoid Arthritis 1171 0.0259158129323078

Expression

  Differential Expression (7)

Synonym

Accession Q15366 A8K7X6 B4DXP5 F8VYL7 G3V0E8 I6L8F9 Q32Q82 Q59HD4 Q68Y55 Q6IPF4 Q6PKG5
Symbols HNRPE2
HNRNPE2
hnRNP-E2

Gene

PDB

2AXY   2JZX   2P2R   2PQU   2PY9  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (45)

PMID Text
26896798 alphaCP1/ alphaCP2 binding to a cytosine-rich subset of polypyrimidine tracts drives a novel pathway of cassette exon splicing in the mammalian transcriptome.
26803058 beta2-adrenergic receptor signaling promotes pancreatic ductal adenocarcinoma progression by facilitating PCBP2-dependent c-myc expression.
26722446 our data indicate that miR-214 may function as tumor suppressor in glioma by targeting PCBP2
26116532 PCBP2 knockdown promoted angiotensin II-induced hypertrophy (increase in cell size, protein synthesis and activation of fetal genes) of cardiomyocytes, while PCBP2 overexpression obtained oppose effects.
26002461 Protein and mRNA levels of PCBP2 were down-regulated under insulin-resistant conditions. Over-expression of PCBP2 inhibits HIF1alpha and STAT3 pathway.
25717101 STAT3 functions via cellular PCBP2 to regulate B-cell lytic susceptibility by restraining Epstein-Barr Virus lytic activation.
25496916 Poly(rC) binding protein 2 (PCBP2) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
24843120 PCBP1 and PCBP2 may serve as iron chaperones to multiple classes of cytosolic nonheme iron enzymes and may have a particular role in restoring metal cofactors that are spontaneously lost in iron deficient cells.
24796666 PCBP2-depletion induces apoptosis in gastric cancer cells via up-regulating expression of pro-apoptotic proteins and down-regulating anti-apoptotic proteins. miR-34a is a target of PCBP2, and miR-34a is critically essential for the function of PCBP2.
24607900 SIRT6 inhibits glioma cell proliferation and colony formation in vitro and glioma cell growth in vivo in a PCBP2 dependent manner. SIRT6 inhibits PCBP2 expression through deacetylating H3K9ac and SIRT6 acts as a tumor suppressor in glioma.
More...

AA Sequence

MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFK      1 - 70
AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN     71 - 140
STERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFP    141 - 210
HTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWG    211 - 280
LDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYL    281 - 350
INVRLSSETGGMGSS                                                           351 - 365
//

Text Mined References (90)

PMID Year Title
26896798 2016 ?CP binding to a cytosine-rich subset of polypyrimidine tracts drives a novel pathway of cassette exon splicing in the mammalian transcriptome.
26803058 2016 ?2-adrenergic receptor signaling promotes pancreatic ductal adenocarcinoma (PDAC) progression through facilitating PCBP2-dependent c-myc expression.
26722446 2015 MicroRNA-214 targets PCBP2 to suppress the proliferation and growth of glioma cells.
26116532 2015 The RNA-binding protein PCBP2 inhibits Ang II-induced hypertrophy of cardiomyocytes though promoting GPR56 mRNA degeneration.
26002461 2015 PCBP2 regulates hepatic insulin sensitivity via HIF-1? and STAT3 pathway in HepG2 cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25717101 2015 Cellular STAT3 functions via PCBP2 to restrain Epstein-Barr Virus lytic activation in B lymphocytes.
25416956 2014 A proteome-scale map of the human interactome network.
24843120 2014 Iron chaperones PCBP1 and PCBP2 mediate the metallation of the dinuclear iron enzyme deoxyhypusine hydroxylase.
24796666 2014 The RNA-binding protein PCBP2 facilitates gastric carcinoma growth by targeting miR-34a.
More...