Property Summary

NCBI Gene PubMed Count 86
Grant Count 23
R01 Count 14
Funding $3,131,372.27
PubMed Score 72.31
PubTator Score 67.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.369 0.000
non primary Sjogren syndrome sicca 1.400 0.026
ovarian cancer 2.000 0.000

Gene RIF (59)

PMID Text
26896798 alphaCP1/ alphaCP2 binding to a cytosine-rich subset of polypyrimidine tracts drives a novel pathway of cassette exon splicing in the mammalian transcriptome.
26293996 results showed for the first time that expression of PCBP1 was down-regulated in newly diagnosed acute myeloid leukemia patients
26261610 Suggest that PCBP1 might play an important role in preventing the process of epithelial mesenchymal transformation in NSCLC.
26173642 PCBP1 mutations are recurrent in Burkitt lymphomas and might contribute, in cooperation with other mutations, to its pathogenesis.
26096938 Inhibin betaA is translationally regulated by TGFbeta via hnRNP E1.
25661993 Our proteomic profiling and subsequent validation indicate that PCBP1 is central to cancer stem cells enrichment and functionality in prostate cancer.
25612617 Findings provide mechanistic evidence for HOTAIR overexpression and PCBP1 downregulation in gastric cancer metastasis and their correlation with poor survival.
25505242 The interaction of HIV-1 CA with human cellular poly(rC) binding protein 1 (PCBP1, hnRNP E1: heterogenous nuclear ribonucleoprotein E1) is identified by yeast two-hybrid screen
25496916 The interaction of HIV-1 CA with human cellular poly(rC) binding protein 1 (PCBP1, hnRNP E1: heterogenous nuclear ribonucleoprotein E1) is identified by yeast two-hybrid screen
25389050 hnRNP E1 is a new regulator of protein disulphide isomerase translation in oxLDL-activated vascular endothelial cells.
More...

AA Sequence

MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFK      1 - 70
AFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN     71 - 140
STERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCSDAAGYPHA    141 - 210
THDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT    211 - 280
THELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSE    281 - 350
KGMGCS                                                                    351 - 356
//

Text Mined References (100)

PMID Year Title
26896798 2016 ?CP binding to a cytosine-rich subset of polypyrimidine tracts drives a novel pathway of cassette exon splicing in the mammalian transcriptome.
26293996 2015 Downregulated Poly-C binding protein-1 is a novel predictor associated with poor prognosis in Acute Myeloid Leukemia.
26261610 2015 Expression of poly(C)-binding protein 1 (PCBP1) in NSCLC as a negative regulator of EMT and its clinical value.
26173642 2015 The PCBP1 gene encoding poly(rC) binding protein I is recurrently mutated in Burkitt lymphoma.
26096938 2016 Translational regulation of inhibin ?A by TGF? via the RNA-binding protein hnRNP E1 enhances the invasiveness of epithelial-to-mesenchymal transitioned cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25661993 2015 Poly r(C) binding protein-1 is central to maintenance of cancer stem cells in prostate cancer cells.
25612617 2015 HOTAIR Long Noncoding RNA Promotes Gastric Cancer Metastasis through Suppression of Poly r(C)-Binding Protein (PCBP) 1.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
More...