Property Summary

NCBI Gene PubMed Count 100
PubMed Score 83.14
PubTator Score 67.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.7e-06
Multiple myeloma 1332 2.9e-04
non primary Sjogren syndrome sicca 891 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.369 2.9e-04
non primary Sjogren syndrome sicca 1.400 2.6e-02
ovarian cancer -1.400 2.7e-06

Gene RIF (65)

AA Sequence

MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISEGNCPERIITLTGPTNAIFK      1 - 70
AFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN     71 - 140
STERAITIAGVPQSVTECVKQICLVMLETLSQSPQGRVMTIPYQPMPASSPVICAGGQDRCSDAAGYPHA    141 - 210
THDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGFAGIDSSSPEVKGYWASLDASTQT    211 - 280
THELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTITGSAASISLAQYLINARLSSE    281 - 350
KGMGCS                                                                    351 - 356
//

Text Mined References (115)

PMID Year Title