Property Summary

NCBI Gene PubMed Count 16
PubMed Score 15.01
PubTator Score 28.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -2.400 0.019
Atopic dermatitis -1.300 0.004
non-small cell lung cancer 1.298 0.000
lung cancer 3.500 0.000
subependymal giant cell astrocytoma -1.322 0.011

Synonym

Accession Q15323 Q9UE12
Symbols HA1
Ha-1
hHa1
KRTHA1

Gene

Gene RIF (1)

PMID Text
15140206 the co-expression of LEF1 and beta-catenin, which in the hair follicle may initiate cortex cell differentiation through the induction of hair keratin hHa1 expression is not preserved in upper transitional cells of pilomatricomas.

AA Sequence

MPYNFCLPSLSCRTSCSSRPCVPPSCHSCTLPGACNIPANVSNCNWFCEGSFNGSEKETMQFLNDRLASY      1 - 70
LEKVRQLERDNAELENLIRERSQQQEPLLCPSYQSYFKTIEELQQKILCTKSENARLVVQIDNAKLAADD     71 - 140
FRTKYQTELSLRQLVESDINGLRRILDELTLCKSDLEAQVESLKEELLCLKSNHEQEVNTLRCQLGDRLN    141 - 210
VEVDAAPTVDLNRVLNETRSQYEALVETNRREVEQWFTTQTEELNKQVVSSSEQLQSYQAEIIELRRTVN    211 - 280
ALEIELQAQHNLRDSLENTLTESEARYSSQLSQVQSLITNVESQLAEIRSDLERQNQEYQVLLDVRARLE    281 - 350
CEINTYRSLLESEDCNLPSNPCATTNACSKPIGPCLSNPCTSCVPPAPCTPCAPRPRCGPCNSFVR        351 - 416
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16831889 2006 New consensus nomenclature for mammalian keratins.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15140206 2004 On the regulation of hair keratin expression: lessons from studies in pilomatricomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10391933 1999 The catalog of human hair keratins. I. Expression of the nine type I members in the hair follicle.
More...