Property Summary

NCBI Gene PubMed Count 35
Grant Count 18
R01 Count 15
Funding $1,034,080.67
PubMed Score 18.57
PubTator Score 15.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -2.900 0.000
atypical teratoid / rhabdoid tumor -1.100 0.006
Pick disease 1.100 0.004

Gene RIF (8)

PMID Text
26671109 This study demonstrated that RBQ3 might play an important role in glioma, and RBQ3 inhibitors might be novel anti-tumor agents.
24680668 Non active site mutations in the MLL1 SET domain render the protein defective for H3K4 dimethylation by the MLL1 core complex, which is associated with a loss of the ability of MLL1 to interact with WRAD or with the RbBP5/Ash2L heterodimer.
24235145 Data indicate that MLL1 methylates Ash2L in the absence of histone H3, but only when assembled within a complex with WDR5 and RbBP5.
22231628 structural and biochemical analyses reveal a basic surface on Ash2L as the RbBP5-binding interface, and this interface is crucial for both RbBP5 binding and MLL1 methyltransferase activity regulation
21124902 MLL1 SET domain make direct contacts with the substrates and contribute to the formation of a joint catalytic center.
20085832 Results show that Depletion of CHD8 enhances HOXA2 expression and a loss of the WDR5/Ash2L/RbBP5 subcomplex.
19131338 The identified components revealed factors involved in histone methylation and cell cycle control and include Ash2L, RbBP5, WDR5, HCF-1, DBC-1, and EMSY.
16604156 analysis of menin's role as a tumor suppressor and binding sites of Rbbp5 and MLL1

AA Sequence

MNLELLESFGQNYPEEADGTLDCISMALTCTFNRWGTLLAVGCNDGRIVIWDFLTRGIAKIISAHIHPVC      1 - 70
SLCWSRDGHKLVSASTDNIVSQWDVLSGDCDQRFRFPSPILKVQYHPRDQNKVLVCPMKSAPVMLTLSDS     71 - 140
KHVVLPVDDDSDLNVVASFDRRGEYIYTGNAKGKILVLKTDSQDLVASFRVTTGTSNTTAIKSIEFARKG    141 - 210
SCFLINTADRIIRVYDGREILTCGRDGEPEPMQKLQDLVNRTPWKKCCFSGDGEYIVAGSARQHALYIWE    211 - 280
KSIGNLVKILHGTRGELLLDVAWHPVRPIIASISSGVVSIWAQNQVENWSAFAPDFKELDENVEYEERES    281 - 350
EFDIEDEDKSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKALLYLPIAPEVEDPEENPYGPPP    351 - 420
DAVQTSLMDEGASSEKKRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVKGDGKSKKKQAGRPKGS    421 - 490
KGKEKDSPFKPKLYKGDRGLPLEGSAKGKVQAELSQPLTAGGAISELL                          491 - 538
//

Text Mined References (43)

PMID Year Title
26671109 2015 Expression and clinical role of RBQ3 in gliomas.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24680668 2014 A non-active-site SET domain surface crucial for the interaction of MLL1 and the RbBP5/Ash2L heterodimer within MLL family core complexes.
24235145 2014 Automethylation activities within the mixed lineage leukemia-1 (MLL1) core complex reveal evidence supporting a "two-active site" model for multiple histone H3 lysine 4 methylation.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23870121 2013 SET1 and p300 act synergistically, through coupled histone modifications, in transcriptional activation by p53.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23178126 2012 Microcephaly gene links trithorax and REST/NRSF to control neural stem cell proliferation and differentiation.
22231628 2012 Structure of the SPRY domain of human Ash2L and its interactions with RbBP5 and DPY30.
More...