Property Summary

NCBI Gene PubMed Count 1
Grant Count 1
Funding $48,148
PubMed Score 1.47
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

AA Sequence

MDGRAELPAFPRAGAPPLAASDTVPAAPEGAGAARPAAPLRPTSFSVLDILDPNKFNSRRRRCVLLGPVA      1 - 70
PAACAPCASAPCAPAPAASGRPPRAEELERRALAGAGGVGAAGAEPPNAGDPFKAGEAETNDTNGYSSGG     71 - 140
GGHSPSADSGDEVPDDEDDDEDEAPETEAARGAEEARGGGGGLGARGSGCQGAAETDASPGATVDEAAAP    141 - 210
GPRENSPVAQGPPGGAAAPGGAGTTPQGTATAAKPKRKRTGSDSKSGKPRRARTAFTYEQLVALENKFKA    211 - 280
TRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADTSAPTGGGGGPGPGAGPGTGLPGGLSPL    281 - 350
SPSPPMGAPLGMHGPAGYPAHGPGGLVCAAQLPFLSSPAVLSPFVLGSQTYGAPAFYAPHL             351 - 411
//

Text Mined References (2)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
7518789 1994 Identification of homeobox genes expressed in human haemopoietic progenitor cells.