Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.47
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.89576106553691E-8
osteosarcoma 7933 1.24346731100017E-5
medulloblastoma, large-cell 6234 2.07978602669071E-4

AA Sequence

MDGRAELPAFPRAGAPPLAASDTVPAAPEGAGAARPAAPLRPTSFSVLDILDPNKFNSRRRRCVLLGPVA      1 - 70
PAACAPCASAPCAPAPAASGRPPRAEELERRALAGAGGVGAAGAEPPNAGDPFKAGEAETNDTNGYSSGG     71 - 140
GGHSPSADSGDEVPDDEDDDEDEAPETEAARGAEEARGGGGGLGARGSGCQGAAETDASPGATVDEAAAP    141 - 210
GPRENSPVAQGPPGGAAAPGGAGTTPQGTATAAKPKRKRTGSDSKSGKPRRARTAFTYEQLVALENKFKA    211 - 280
TRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADTSAPTGGGGGPGPGAGPGTGLPGGLSPL    281 - 350
SPSPPMGAPLGMHGPAGYPAHGPGGLVCAAQLPFLSSPAVLSPFVLGSQTYGAPAFYAPHL             351 - 411
//

Text Mined References (2)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
7518789 1994 Identification of homeobox genes expressed in human haemopoietic progenitor cells.