Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.97
PubTator Score 10.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.9e-08
osteosarcoma 7950 1.2e-05
medulloblastoma, large-cell 6241 2.1e-04

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 2.1e-04
osteosarcoma 1.423 1.2e-05
ovarian cancer 1.600 1.9e-08

AA Sequence

MDGRAELPAFPRAGAPPLAASDTVPAAPEGAGAARPAAPLRPTSFSVLDILDPNKFNSRRRRCVLLGPVA      1 - 70
PAACAPCASAPCAPAPAASGRPPRAEELERRALAGAGGVGAAGAEPPNAGDPFKAGEAETNDTNGYSSGG     71 - 140
GGHSPSADSGDEVPDDEDDDEDEAPETEAARGAEEARGGGGGLGARGSGCQGAAETDASPGATVDEAAAP    141 - 210
GPRENSPVAQGPPGGAAAPGGAGTTPQGTATAAKPKRKRTGSDSKSGKPRRARTAFTYEQLVALENKFKA    211 - 280
TRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADTSAPTGGGGGPGPGAGPGTGLPGGLSPL    281 - 350
SPSPPMGAPLGMHGPAGYPAHGPGGLVCAAQLPFLSSPAVLSPFVLGSQTYGAPAFYAPHL             351 - 411
//

Text Mined References (6)

PMID Year Title