Property Summary

NCBI Gene PubMed Count 38
Grant Count 6
R01 Count 2
Funding $633,110
PubMed Score 27.79
PubTator Score 28.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (19)

PMID Text
25612622 PTPRK underexpression leads to STAT3 activation and contributes to nasal NK/T-cell lymphoma pathogenesis
25609089 Notch and TGF-beta act in concert to stimulate induction of PTPRK, which suppresses EGFR activation in human keratinocytes.
25378349 By regulating phosphorylation of SRC, RPTPkappa promotes the pathogenic action of rheumatoid arthritis fibroblast-like synoviocytes, mediating cross-activation of growth factor and inflammatory cytokine signalling by TGFbeta in RA FLS.
24882578 Findings strongly indicate that the tyrosine phosphorylation of CD133, which is dephosphorylated by PTPRK, regulates AKT signaling and has a critical role in colon cancer progression.
24002526 High expression of PTPRK is associated with prostate cancer.
23820479 PTPRK showed lower mRNA expression in duodenal mucose of celiac disease patients.
23696788 Tumor derived mutations of protein tyrosine phosphatase receptor type k affect its function and alter sensitivity to chemotherapeutics in glioma.
23552869 PTPRK is a negative regulator of adhesion, invasion, migration, and proliferation of breast cancer cells.
21094132 PTPkappa was scissored by the processed form of proprotein convertase 5, and galectin-3 binding protein which is over-produced in colon cancer cells and tissues.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSAGGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPP      1 - 70
EMPQGSYMIVDSSDHDPGEKARLQLPTMKENDTHCIDFSYLLYSQKGLNPGTLNILVRVNKGPLANPIWN     71 - 140
VTGFTGRDWLRAELAVSTFWPNEYQVIFEAEVSGGRSGYIAIDDIQVLSYPCDKSPHFLRLGDVEVNAGQ    141 - 210
NATFQCIATGRDAVHNKLWLQRRNGEDIPVAQTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERGSGV    211 - 280
SNFAQLIVREPPRPIAPPQLLGVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSWTETHAVNAPTYKL    281 - 350
WHLDPDTEYEIRVLLTRPGEGGTGLPGPPLITRTKCAEPMRTPKTLKIAEIQARRIAVDWESLGYNITRC    351 - 420
HTFNVTICYHYFRGHNESKADCLDMDPKAPQHVVNHLPPYTNVSLKMILTNPEGRKESEETIIQTDEDVP    421 - 490
GPVPVKSLQGTSFENKIFLNWKEPLDPNGIITQYEISYSSIRSFDPAVPVAGPPQTVSNLWNSTHHVFMH    491 - 560
LHPGTTYQFFIRASTVKGFGPATAINVTTNISAPTLPDYEGVDASLNETATTITVLLRPAQAKGAPISAY    561 - 630
QIVVEELHPHRTKREAGAMECYQVPVTYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPP    631 - 700
LAPRKGYNIYFQAMSSVEKETKTQCVRIATKAATEEPEVIPDPAKQTDRVVKIAGISAGILVFILLLLVV    701 - 770
ILIVKKSKLAKKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAES    771 - 840
SRLLDVPRYLCEGTESPYQTGQLHPAIRVADLLQHINLMKTSDSYGFKEEYESFFEGQSASWDVAKKDQN    841 - 910
RAKNRYGNIIAYDHSRVILQPVEDDPSSDYINANYIDGYQRPSHYIATQGPVHETVYDFWRMIWQEQSAC    911 - 980
IVMVTNLVEVGRVKCYKYWPDDTEVYGDFKVTCVEMEPLAEYVVRTFTLERRGYNEIREVKQFHFTGWPD    981 - 1050
HGVPYHATGLLSFIRRVKLSNPPSAGPIVVHCSAGAGRTGCYIVIDIMLDMAEREGVVDIYNCVKALRSR   1051 - 1120
RINMVQTEEQYIFIHDAILEACLCGETAIPVCEFKAAYFDMIRIDSQTNSSHLKDEFQTLNSVTPRLQAE   1121 - 1190
DCSIACLPRNHDKNRFMDMLPPDRCLPFLITIDGESSNYINAALMDSYRQPAAFIVTQYPLPNTVKDFWR   1191 - 1260
LVYDYGCTSIVMLNEVDLSQGCPQYWPEEGMLRYGPIQVECMSCSMDCDVINRIFRICNLTRPQEGYLMV   1261 - 1330
QQFQYLGWASHREVPGSKRSFLKLILQVEKWQEECEEGEGRTIIHCLNGGGRSGMFCAIGIVVEMVKRQN   1331 - 1400
VVDVFHAVKTLRNSKPNMVEAPEQYRFCYDVALEYLESS                                  1401 - 1439
//

Text Mined References (44)

PMID Year Title
25612622 2015 Receptor-type tyrosine-protein phosphatase ? directly targets STAT3 activation for tumor suppression in nasal NK/T-cell lymphoma.
25609089 2015 Notch and TGF-? pathways cooperatively regulate receptor protein tyrosine phosphatase-? (PTPRK) gene expression in human primary keratinocytes.
25378349 2016 TGF? responsive tyrosine phosphatase promotes rheumatoid synovial fibroblast invasiveness.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24882578 2015 Receptor-type protein tyrosine phosphatase ? directly dephosphorylates CD133 and regulates downstream AKT activation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24002526 2013 Receptor-like protein tyrosine phosphatase ? negatively regulates the apoptosis of prostate cancer cells via the JNK pathway.
23820479 2014 THEMIS and PTPRK in celiac intestinal mucosa: coexpression in disease and after in vitro gliadin challenge.
23696788 2013 Tumor derived mutations of protein tyrosine phosphatase receptor type k affect its function and alter sensitivity to chemotherapeutics in glioma.
23552869 2013 Protein tyrosine phosphatase kappa (PTPRK) is a negative regulator of adhesion and invasion of breast cancer cells, and associates with poor prognosis of breast cancer.
More...