Property Summary

NCBI Gene PubMed Count 40
PubMed Score 31.03
PubTator Score 28.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.072 2.0e-06
aldosterone-producing adenoma -1.184 1.8e-02
Barrett's esophagus 1.200 2.6e-02
Chronic Lymphocytic Leukemia -2.601 9.6e-04
dermatomyositis 1.600 1.5e-03
esophageal adenocarcinoma 1.700 1.9e-02
fibroadenoma 1.100 2.5e-02
glioblastoma -1.500 9.9e-04
group 3 medulloblastoma -1.300 3.8e-03
juvenile dermatomyositis 1.172 1.1e-09
medulloblastoma, large-cell -2.100 3.6e-02
ovarian cancer -1.200 1.3e-03
pediatric high grade glioma -1.100 2.4e-03
pituitary cancer -2.600 2.3e-05
tuberculosis and treatment for 3 months 1.300 1.5e-02

Gene RIF (22)

AA Sequence

MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSAGGCTFDDGPGACDYHQDLYDDFEWVHVSAQEPHYLPP      1 - 70
EMPQGSYMIVDSSDHDPGEKARLQLPTMKENDTHCIDFSYLLYSQKGLNPGTLNILVRVNKGPLANPIWN     71 - 140
VTGFTGRDWLRAELAVSTFWPNEYQVIFEAEVSGGRSGYIAIDDIQVLSYPCDKSPHFLRLGDVEVNAGQ    141 - 210
NATFQCIATGRDAVHNKLWLQRRNGEDIPVAQTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERGSGV    211 - 280
SNFAQLIVREPPRPIAPPQLLGVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSWTETHAVNAPTYKL    281 - 350
WHLDPDTEYEIRVLLTRPGEGGTGLPGPPLITRTKCAEPMRTPKTLKIAEIQARRIAVDWESLGYNITRC    351 - 420
HTFNVTICYHYFRGHNESKADCLDMDPKAPQHVVNHLPPYTNVSLKMILTNPEGRKESEETIIQTDEDVP    421 - 490
GPVPVKSLQGTSFENKIFLNWKEPLDPNGIITQYEISYSSIRSFDPAVPVAGPPQTVSNLWNSTHHVFMH    491 - 560
LHPGTTYQFFIRASTVKGFGPATAINVTTNISAPTLPDYEGVDASLNETATTITVLLRPAQAKGAPISAY    561 - 630
QIVVEELHPHRTKREAGAMECYQVPVTYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPP    631 - 700
LAPRKGYNIYFQAMSSVEKETKTQCVRIATKAATEEPEVIPDPAKQTDRVVKIAGISAGILVFILLLLVV    701 - 770
ILIVKKSKLAKKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAES    771 - 840
SRLLDVPRYLCEGTESPYQTGQLHPAIRVADLLQHINLMKTSDSYGFKEEYESFFEGQSASWDVAKKDQN    841 - 910
RAKNRYGNIIAYDHSRVILQPVEDDPSSDYINANYIDGYQRPSHYIATQGPVHETVYDFWRMIWQEQSAC    911 - 980
IVMVTNLVEVGRVKCYKYWPDDTEVYGDFKVTCVEMEPLAEYVVRTFTLERRGYNEIREVKQFHFTGWPD    981 - 1050
HGVPYHATGLLSFIRRVKLSNPPSAGPIVVHCSAGAGRTGCYIVIDIMLDMAEREGVVDIYNCVKALRSR   1051 - 1120
RINMVQTEEQYIFIHDAILEACLCGETAIPVCEFKAAYFDMIRIDSQTNSSHLKDEFQTLNSVTPRLQAE   1121 - 1190
DCSIACLPRNHDKNRFMDMLPPDRCLPFLITIDGESSNYINAALMDSYRQPAAFIVTQYPLPNTVKDFWR   1191 - 1260
LVYDYGCTSIVMLNEVDLSQGCPQYWPEEGMLRYGPIQVECMSCSMDCDVINRIFRICNLTRPQEGYLMV   1261 - 1330
QQFQYLGWASHREVPGSKRSFLKLILQVEKWQEECEEGEGRTIIHCLNGGGRSGMFCAIGIVVEMVKRQN   1331 - 1400
VVDVFHAVKTLRNSKPNMVEAPEQYRFCYDVALEYLESS                                  1401 - 1439
//

Text Mined References (46)

PMID Year Title